BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30192 (698 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7RPE8 Cluster: Aspartyl-tRNA synthetase, putative; n=7... 34 3.9 UniRef50_A4XKP9 Cluster: Peptidase S55, SpoIVB; n=1; Caldicellul... 33 5.1 UniRef50_Q23GD9 Cluster: Putative uncharacterized protein; n=1; ... 33 6.7 UniRef50_A0DNP4 Cluster: Chromosome undetermined scaffold_58, wh... 33 6.7 UniRef50_Q2B8M8 Cluster: Secreted protein containing cell-adhesi... 33 8.9 UniRef50_A5K2C8 Cluster: SET domain containing protein; n=4; cel... 33 8.9 UniRef50_A2DND1 Cluster: Putative uncharacterized protein; n=1; ... 33 8.9 >UniRef50_Q7RPE8 Cluster: Aspartyl-tRNA synthetase, putative; n=7; Plasmodium|Rep: Aspartyl-tRNA synthetase, putative - Plasmodium yoelii yoelii Length = 681 Score = 33.9 bits (74), Expect = 3.9 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 212 CINVFQYKNYSIFYYTK*ICVIFKTVILMN 123 CI++ Y NYSIFY IC IF+ ++ N Sbjct: 357 CIDLRTYANYSIFYLQSEICKIFRNYLIDN 386 >UniRef50_A4XKP9 Cluster: Peptidase S55, SpoIVB; n=1; Caldicellulosiruptor saccharolyticus DSM 8903|Rep: Peptidase S55, SpoIVB - Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903) Length = 412 Score = 33.5 bits (73), Expect = 5.1 Identities = 22/79 (27%), Positives = 35/79 (44%), Gaps = 2/79 (2%) Frame = +3 Query: 162 FSV-IKYRVVFILEHVYATWINDY*VSLVDDKAVRAK-PIFFQIQFVKQNKKMNSRSEML 335 FS+ + Y + L +Y DY DK V K P+F + V N ++ +L Sbjct: 6 FSIFLFYLIATTLFFIYLNITPDYLTCYKSDKCVSIKTPVFVDVNSVNNNVLKTIKNNLL 65 Query: 336 FGLSVISLNTRHLSLLLKV 392 F S LN + SL+ ++ Sbjct: 66 FKTSTFYLNNKSNSLICEL 84 >UniRef50_Q23GD9 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 223 Score = 33.1 bits (72), Expect = 6.7 Identities = 25/93 (26%), Positives = 49/93 (52%) Frame = +3 Query: 129 KYNGFKYNTYSFSVIKYRVVFILEHVYATWINDY*VSLVDDKAVRAKPIFFQIQFVKQNK 308 KY KY Y+F+ +++F+ + + +I DY + ++D+ V + Q QF Sbjct: 40 KYLTIKY--YAFAFFWIQILFLSFILNSNYIGDY-NNFINDQQVVNDGLSNQSQF----D 92 Query: 309 KMNSRSEMLFGLSVISLNTRHLSLLLKVPFYLV 407 + ++S + + ++SLN +S +L + FYLV Sbjct: 93 TLFAKSIAIIAVHILSLNIVKISSILTIFFYLV 125 >UniRef50_A0DNP4 Cluster: Chromosome undetermined scaffold_58, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_58, whole genome shotgun sequence - Paramecium tetraurelia Length = 1334 Score = 33.1 bits (72), Expect = 6.7 Identities = 21/83 (25%), Positives = 39/83 (46%) Frame = +3 Query: 6 VKKKTYRHNVFNRFS*LK*NLVSCFIYLMNYDFSYIVRSIHKYNGFKYNTYSFSVIKYRV 185 + KT H + + S + L++ ++ +Y S+ + I + N Y + Y+V Sbjct: 1097 IDPKTQFHRIIIKNSKTQQQLLTVELFCQSYQHSHYILQIQFICSLQNNLYLCPINNYKV 1156 Query: 186 VFILEHVYATWINDY*VSLVDDK 254 V IL+ Y TW Y V + +D+ Sbjct: 1157 VQILQG-YGTWPTSY-VKMYNDQ 1177 >UniRef50_Q2B8M8 Cluster: Secreted protein containing cell-adhesion domains; n=1; Bacillus sp. NRRL B-14911|Rep: Secreted protein containing cell-adhesion domains - Bacillus sp. NRRL B-14911 Length = 1707 Score = 32.7 bits (71), Expect = 8.9 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +3 Query: 147 YNTYSFSVIKYRVVFILEHVYATWINDY*VSLVDDKAVRAKPIFF 281 +N++SF+ Y+ F ++H TWIND + K ++ IFF Sbjct: 854 FNSFSFNQATYKYYFRMDHQPWTWINDSSKKNLVTKKIQDDNIFF 898 >UniRef50_A5K2C8 Cluster: SET domain containing protein; n=4; cellular organisms|Rep: SET domain containing protein - Plasmodium vivax Length = 6587 Score = 32.7 bits (71), Expect = 8.9 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = +2 Query: 2 VGQKKNVSPQRFQSIFVVKVEFSIMFYILNEL 97 + QKKNV + F +FV ++ ++M+ +LNE+ Sbjct: 3024 IRQKKNVKGKNFVHLFVANIDEAVMYPVLNEM 3055 >UniRef50_A2DND1 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 393 Score = 32.7 bits (71), Expect = 8.9 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = -2 Query: 175 FITLNEYVLYLKPLYL*ILRTIYEKS*FIKYIKHDTKFYFNYENRLKTLW 26 F++ NEY LY KPLYL + Y F+ ++ +YF + K LW Sbjct: 213 FLSTNEYQLYRKPLYLVLTNVFYILMFFVTFL---LVYYFEF----KVLW 255 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 599,584,707 Number of Sequences: 1657284 Number of extensions: 11064312 Number of successful extensions: 23161 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 22196 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23158 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 55371905986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -