BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30192 (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F12.12 |par2|pbp2|protein phosphatase regulatory subunit Pa... 28 1.1 SPAC20G8.10c ||SPAC3A12.01c|beclin family protein|Schizosaccharo... 25 7.9 >SPAC6F12.12 |par2|pbp2|protein phosphatase regulatory subunit Par2|Schizosaccharomyces pombe|chr 1|||Manual Length = 627 Score = 28.3 bits (60), Expect = 1.1 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = +3 Query: 192 ILEHVYATWINDY*VSLVDDKAVRAKPIFFQIQFVKQNKKMNS 320 + E W N+Y SLV V PI + + N+ NS Sbjct: 522 VAERALCLWSNEYFTSLVSQNVVTLLPIIYPSLYKTANEHWNS 564 >SPAC20G8.10c ||SPAC3A12.01c|beclin family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 464 Score = 25.4 bits (53), Expect = 7.9 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -2 Query: 106 EKS*FIKYIKHDTKFYFNYENRLKT 32 E S ++ +K + K YFNY+N L + Sbjct: 153 EMSKTLRALKEEKKMYFNYDNFLSS 177 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,725,290 Number of Sequences: 5004 Number of extensions: 54480 Number of successful extensions: 110 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -