BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30192 (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26612| Best HMM Match : NC (HMM E-Value=6.7) 30 2.1 SB_8719| Best HMM Match : SEA (HMM E-Value=4.7e-11) 28 6.3 SB_29472| Best HMM Match : DUF964 (HMM E-Value=4.7) 28 8.4 >SB_26612| Best HMM Match : NC (HMM E-Value=6.7) Length = 451 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +3 Query: 156 YSFSVIKYRVVFILEHVYATWINDY*VSLVDDKAVRAKPIFFQIQFV 296 Y+ SV YR+ +++ VY + + V+LV D A FF++ V Sbjct: 294 YTASVTFYRLTPVMDTVYTASVTFFRVTLVMDTVYTASVTFFRVTLV 340 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +3 Query: 156 YSFSVIKYRVVFILEHVYATWINDY*VSLVDDKAVRAKPIFFQI 287 Y+ SV +RV ++ VY + Y ++LV D A FF++ Sbjct: 328 YTASVTFFRVTLVMNTVYTASVTFYRLTLVMDTVYTASVTFFRV 371 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +3 Query: 156 YSFSVIKYRVVFILEHVYATWINDY*VSLVDDKAVRAKPIFFQIQFV 296 Y+ SV YR+ +++ VY + Y ++ V D A FF++ V Sbjct: 277 YTASVTFYRLTLVMDTVYTASVTFYRLTPVMDTVYTASVTFFRVTLV 323 >SB_8719| Best HMM Match : SEA (HMM E-Value=4.7e-11) Length = 905 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = +3 Query: 75 CFIYLMNYDFSYIVRSIHKYNGFKYNTYSFSVIKYRVVFILEHVY 209 C ++ +YD+ + Y Y++Y++ V+ Y + EH Y Sbjct: 804 CMVFYDSYDYKLVFYGFFAYKVVFYDSYAYKVVFYD-SYAYEHKY 847 >SB_29472| Best HMM Match : DUF964 (HMM E-Value=4.7) Length = 344 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +3 Query: 297 KQNKKMNSRSEMLFGLSVISLNTRHLSLLLKVPFYLVLAS 416 K+ ++++++ E GLS L H SLLLK YL L+S Sbjct: 243 KETEELSTKPEQGEGLSEDELALFHNSLLLKTNSYLSLSS 282 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,251,509 Number of Sequences: 59808 Number of extensions: 326940 Number of successful extensions: 534 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 534 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -