BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30192 (698 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68006-3|CAA91997.2| 633|Caenorhabditis elegans Hypothetical pr... 28 5.6 Z83239-8|CAH60787.1| 311|Caenorhabditis elegans Hypothetical pr... 27 9.8 Z46812-2|CAA86844.1| 1027|Caenorhabditis elegans Hypothetical pr... 27 9.8 >Z68006-3|CAA91997.2| 633|Caenorhabditis elegans Hypothetical protein K09C8.4 protein. Length = 633 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -3 Query: 348 HLNQTAFHFSNSFFYFVSQIEFEKKLAW 265 H T+++ SN ++F + EFEK++AW Sbjct: 75 HELMTSWNISNCEWFFHNLTEFEKRVAW 102 >Z83239-8|CAH60787.1| 311|Caenorhabditis elegans Hypothetical protein T09F5.16 protein. Length = 311 Score = 27.5 bits (58), Expect = 9.8 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +3 Query: 75 CFIYLMNYDFSYIVRSIHKYNGFKYNTYSFSVIKYRVVFILEHVYATWINDY 230 C ++ NY+ Y+ S+ N N Y +IK ++ IL ++Y I Y Sbjct: 118 CLYFMPNYE-KYLNISVEALNVVVRNLYICFIIKSVMLIILPYIYTANILTY 168 >Z46812-2|CAA86844.1| 1027|Caenorhabditis elegans Hypothetical protein ZK675.2 protein. Length = 1027 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -2 Query: 628 HLKKDIHCFILNTIRFNSRGETLFGLSDIFASLPK 524 H++K + C I IRF RGE + ++ I A L + Sbjct: 685 HVRKSVSCDINYGIRFTKRGEVIQLMTAIGAELER 719 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,657,171 Number of Sequences: 27780 Number of extensions: 290812 Number of successful extensions: 641 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 641 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -