BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30192 (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 23 2.1 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 3.7 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 8.5 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 255 LYRPLVKLNNH*SMLHKR 202 ++R L LNNH S+ H+R Sbjct: 410 VFRTLNSLNNHKSIYHRR 427 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +3 Query: 303 NKKMNSRSEMLFGLSVISLNTRHLSLLLKVPFYL 404 N N +++++ + I LNT + L PF+L Sbjct: 211 NHDYNLENKLIYFIEDIGLNTYYFFLRQAFPFWL 244 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 117 RSIHKYNGFKYN 152 R+IH N +KYN Sbjct: 88 RTIHNNNNYKYN 99 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,604 Number of Sequences: 438 Number of extensions: 3918 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -