BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30191X (300 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21409| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.23 SB_59531| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 26 4.9 SB_52935| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.9 SB_52374| Best HMM Match : GATase_2 (HMM E-Value=0) 26 4.9 SB_46870| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 26 4.9 SB_38523| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.9 SB_22197| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 26 4.9 SB_16302| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 26 4.9 SB_14793| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.9 SB_45444| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.6 SB_29467| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.6 SB_27857| Best HMM Match : Cadherin (HMM E-Value=0) 25 8.6 SB_1062| Best HMM Match : Sushi (HMM E-Value=2.2) 25 8.6 SB_28695| Best HMM Match : Ras (HMM E-Value=0) 25 8.6 >SB_21409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 30.7 bits (66), Expect = 0.23 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = +3 Query: 111 LVTRAQG-DIQIEGFNPSAEEADEGTDSAVESGVDIVLNHRLVE 239 +V+ QG D + G N SAE+A + + +G ++V+ +RLVE Sbjct: 39 IVSEKQGIDENLIGGNKSAEDACDDVEDGCTTGCNVVMANRLVE 82 >SB_59531| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 323 Score = 26.2 bits (55), Expect = 4.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 283 FLRQCVGFLVPKAYVSTSLWFRTMST 206 F + C G VPK VS + W T++T Sbjct: 37 FAKVCKGKAVPKERVSAATWSPTLAT 62 >SB_52935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1333 Score = 26.2 bits (55), Expect = 4.9 Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -2 Query: 158 RIKTLDLDITLCSRHQPTGHFVN-NFIDQFH 69 + T+D+D+ + H P F+N F+D H Sbjct: 692 KCSTIDMDVNYMTIHMPHQLFINGEFVDSHH 722 >SB_52374| Best HMM Match : GATase_2 (HMM E-Value=0) Length = 1075 Score = 26.2 bits (55), Expect = 4.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 283 FLRQCVGFLVPKAYVSTSLWFRTMST 206 F + C G VPK VS + W T++T Sbjct: 150 FAKVCKGKAVPKERVSAATWSPTLAT 175 >SB_46870| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) Length = 998 Score = 26.2 bits (55), Expect = 4.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 283 FLRQCVGFLVPKAYVSTSLWFRTMST 206 F + C G VPK VS + W T++T Sbjct: 242 FAKVCKGKAVPKERVSAATWSPTLAT 267 >SB_38523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 26.2 bits (55), Expect = 4.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 283 FLRQCVGFLVPKAYVSTSLWFRTMST 206 F + C G VPK VS + W T++T Sbjct: 426 FAKVCKGKAVPKERVSAATWSPTLAT 451 >SB_22197| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 528 Score = 26.2 bits (55), Expect = 4.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 283 FLRQCVGFLVPKAYVSTSLWFRTMST 206 F + C G VPK VS + W T++T Sbjct: 242 FAKVCKGKAVPKERVSAATWSPTLAT 267 >SB_16302| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) Length = 870 Score = 26.2 bits (55), Expect = 4.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 283 FLRQCVGFLVPKAYVSTSLWFRTMST 206 F + C G VPK VS + W T++T Sbjct: 242 FAKVCKGKAVPKERVSAATWSPTLAT 267 >SB_14793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 821 Score = 26.2 bits (55), Expect = 4.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 283 FLRQCVGFLVPKAYVSTSLWFRTMST 206 F + C G VPK VS + W T++T Sbjct: 526 FAKVCKGKAVPKERVSAATWSPTLAT 551 >SB_45444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 25.4 bits (53), Expect = 8.6 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 3/72 (4%) Frame = +3 Query: 21 YKDIITGDEMFSDTYKMKLVDEVIYEVTGRLVTRAQGDI---QIEGFNPSAEEADEGTDS 191 +++I+T E ++ ++K + VT R + + G +IE F +AEE E + Sbjct: 31 WEEIVTRLE--NEVQQLKNPGNAVVYVTRRKLKKFDGQTSAPEIEEFKENAEEIQELRNL 88 Query: 192 AVESGVDIVLNH 227 + D VL+H Sbjct: 89 NGKQAADFVLSH 100 >SB_29467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 25.4 bits (53), Expect = 8.6 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 134 ITLCSRHQPTGHF 96 +TLC R +P GHF Sbjct: 120 VTLCHREKPVGHF 132 >SB_27857| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2418 Score = 25.4 bits (53), Expect = 8.6 Identities = 14/53 (26%), Positives = 21/53 (39%) Frame = +3 Query: 102 TGRLVTRAQGDIQIEGFNPSAEEADEGTDSAVESGVDIVLNHRLVETYAFGTR 260 +G VT G EGFNPS G +E ++ + ++ TR Sbjct: 604 SGTFVTVVVGRDADEGFNPSYTVITPGVPYKIEPSTGVIRTSKSLDQSELSTR 656 >SB_1062| Best HMM Match : Sushi (HMM E-Value=2.2) Length = 100 Score = 25.4 bits (53), Expect = 8.6 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 269 CRISCTEGVCFD*PVVQDYVNSALDGR 189 CR+SC F+ DY+ S LDG+ Sbjct: 55 CRVSCNLYYDFEFLAAPDYICSDLDGK 81 >SB_28695| Best HMM Match : Ras (HMM E-Value=0) Length = 1058 Score = 25.4 bits (53), Expect = 8.6 Identities = 15/62 (24%), Positives = 33/62 (53%) Frame = +3 Query: 15 KIYKDIITGDEMFSDTYKMKLVDEVIYEVTGRLVTRAQGDIQIEGFNPSAEEADEGTDSA 194 K+Y+++ ++ DTY+ +L DE+ + G + + + +E N + EE + S+ Sbjct: 613 KLYEEMEQQIKVVRDTYQQELEDEIAMKEKGEQEIKTENEKLLEK-NWTLEEQLNSSVSS 671 Query: 195 VE 200 +E Sbjct: 672 LE 673 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,557,137 Number of Sequences: 59808 Number of extensions: 137742 Number of successful extensions: 377 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 377 length of database: 16,821,457 effective HSP length: 71 effective length of database: 12,575,089 effective search space used: 352102492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -