BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30191X (300 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16640.1 68416.m02127 translationally controlled tumor family... 67 2e-12 At3g05540.1 68416.m00607 translationally controlled tumor family... 48 1e-06 At4g29060.1 68417.m04157 elongation factor Ts family protein sim... 34 0.015 At1g63100.1 68414.m07128 scarecrow transcription factor family p... 27 1.8 At5g51800.1 68418.m06423 expressed protein 27 3.1 At4g12570.1 68417.m01983 ubiquitin-protein ligase, putative simi... 27 3.1 At1g63910.1 68414.m07236 myb family transcription factor (MYB103... 27 3.1 At1g09640.1 68414.m01081 elongation factor 1B-gamma, putative / ... 27 3.1 At3g13380.1 68416.m01683 leucine-rich repeat family protein / pr... 26 5.4 At2g29810.1 68415.m03621 kelch repeat-containing F-box family pr... 26 5.4 At1g53210.1 68414.m06031 sodium/calcium exchanger family protein... 26 5.4 At5g49070.1 68418.m06072 beta-ketoacyl-CoA synthase family prote... 25 7.1 At4g19500.1 68417.m02868 disease resistance protein (TIR-NBS-LRR... 25 9.4 At4g13920.1 68417.m02154 disease resistance family protein / LRR... 25 9.4 At4g01660.1 68417.m00216 ABC1 family protein contains Pfam domai... 25 9.4 At3g17800.1 68416.m02270 expressed protein 25 9.4 At1g50420.1 68414.m05651 scarecrow-like transcription factor 3 (... 25 9.4 At1g50200.1 68414.m05629 aminoacyl-tRNA synthetase family protei... 25 9.4 >At3g16640.1 68416.m02127 translationally controlled tumor family protein similar to translationally controlled tumor protein GB:AAD10032 from [Hevea brasiliensis] Length = 168 Score = 66.9 bits (156), Expect = 2e-12 Identities = 37/96 (38%), Positives = 57/96 (59%), Gaps = 3/96 (3%) Frame = +3 Query: 12 MKIYKDIITGDEMFSDTYKMKLVDE-VIYEVTGRLVTRAQGDIQIEGFNPSAEEA--DEG 182 M +Y+D++TGDE+ SD++ K ++ +++EV G+ VT D+ I G NPSAEE DEG Sbjct: 1 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVTVGAVDVNI-GANPSAEEGGEDEG 59 Query: 183 TDSAVESGVDIVLNHRLVETYAFGTRNPTHCLKNYM 290 D + + VDIV RL E + + +K Y+ Sbjct: 60 VDDSTQKVVDIVDTFRLQEQPTYDKKGFIAYIKKYI 95 >At3g05540.1 68416.m00607 translationally controlled tumor family protein similar to translationally controlled tumor protein GB:AAD10032 from [Hevea brasiliensis] Length = 156 Score = 48.0 bits (109), Expect = 1e-06 Identities = 33/95 (34%), Positives = 48/95 (50%), Gaps = 2/95 (2%) Frame = +3 Query: 12 MKIYKDIITGDEMFSDTYKMKLVDEVIYEVTGRLVTRAQGDIQIEGFNPSAEEA--DEGT 185 M +Y+DI+TGDE+ SD++ K ++ G L ++EG NPS EE DEG Sbjct: 1 MLVYQDILTGDELLSDSFPYKEIE------NGML-------WEVEGKNPSGEEGGEDEGV 47 Query: 186 DSAVESGVDIVLNHRLVETYAFGTRNPTHCLKNYM 290 D VDI+ RL E +F + +K Y+ Sbjct: 48 DDQAVKVVDIIDTFRLQEQPSFDKKQFVMFMKRYI 82 >At4g29060.1 68417.m04157 elongation factor Ts family protein similar to SP|P35019 Elongation factor Ts (EF-Ts) {Galdieria sulphuraria}; contains Pfam profiles PF00627: UBA/TS-N domain, PF00889: Elongation factor TS, PF00575: S1 RNA binding domain Length = 953 Score = 34.3 bits (75), Expect = 0.015 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = +3 Query: 39 GDEMFSDTYKMKLVDEVIYEVT--GRLVTRAQGDIQIEGFNPSAEEADEGTDSAVESG 206 G+ S K +++D V+ +T G +T +G+ EGF P+AEEAD+G S + G Sbjct: 238 GEGFNSKFAKGQMLDGVVKNLTRSGAFITIGEGE---EGFLPTAEEADDGIGSMMMGG 292 >At1g63100.1 68414.m07128 scarecrow transcription factor family protein similar to GI:1497987 from [Arabidopsis thaliana] (Cell (1996) In press) Length = 658 Score = 27.5 bits (58), Expect = 1.8 Identities = 22/63 (34%), Positives = 29/63 (46%) Frame = +3 Query: 78 VDEVIYEVTGRLVTRAQGDIQIEGFNPSAEEADEGTDSAVESGVDIVLNHRLVETYAFGT 257 VD VI E+ G GD +E P+A + G S S L+HR+ E G+ Sbjct: 189 VDSVITELAGI------GDKDVESSLPAAVKEASGGSSTSASSESRSLSHRVPEP-TNGS 241 Query: 258 RNP 266 RNP Sbjct: 242 RNP 244 >At5g51800.1 68418.m06423 expressed protein Length = 972 Score = 26.6 bits (56), Expect = 3.1 Identities = 11/41 (26%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +3 Query: 6 IKMKIYKDIITGDEMFSDTYKMKLVD--EVIYEVTGRLVTR 122 ++ +YKD+ G E+F +L+D + Y++ G +++R Sbjct: 540 LRPDVYKDLPQGKELFFSISSTELLDCRAITYDIIGPIMSR 580 >At4g12570.1 68417.m01983 ubiquitin-protein ligase, putative similar to SP|P39940 Ubiquitin--protein ligase RSP5 (EC 6.3.2.-) {Saccharomyces cerevisiae}; contains Pfam profiles PF00240: Ubiquitin family, PF00632: HECT-domain (ubiquitin-transferase) Length = 873 Score = 26.6 bits (56), Expect = 3.1 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -2 Query: 245 VCFD*PVVQDYVNSALDGRVRALVSLFSRRIKTLDL 138 V F P+V ++AL+ +R L LF + T+DL Sbjct: 369 VAFPIPIVLPMQSTALEAEIRHLHRLFGSLLTTMDL 404 >At1g63910.1 68414.m07236 myb family transcription factor (MYB103) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 370 Score = 26.6 bits (56), Expect = 3.1 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 Query: 122 SRHQPTGHFVNNFIDQFHFVSVREHLITSDNVLIDLHFDG 3 SRHQP+ V D + E T+ + + +LHFDG Sbjct: 124 SRHQPSVTTVTLNADTTSIATTIEASTTTTSTIDNLHFDG 163 >At1g09640.1 68414.m01081 elongation factor 1B-gamma, putative / eEF-1B gamma, putative Similar to elongation factor 1-gamma (gb|EF1G_XENLA). ESTs gb|T20564,gb|T45940,gb|T04527 come from this gene Length = 414 Score = 26.6 bits (56), Expect = 3.1 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 147 GFNPSAEEADEGTDSAVESGVDIVLNHRLVETYAFG 254 GF P + A+EG S ++ +D + H TY G Sbjct: 118 GFMPYSAPAEEGAISTLKRALDALNTHLTSNTYLVG 153 >At3g13380.1 68416.m01683 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1164 Score = 25.8 bits (54), Expect = 5.4 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +3 Query: 27 DIITGDEMFSDTYKMKLVDEVIYEVTGRLVTRAQGD 134 D + G F D YK KL D + + + QGD Sbjct: 861 DSMIGSGGFGDVYKAKLADGSVVAIKKLIQVTGQGD 896 >At2g29810.1 68415.m03621 kelch repeat-containing F-box family protein contains Pfam PF00646: F-box domain; contains Pfam PF01344 : Kelch motif; similar to SKP1 interacting partner 6 (GI:10716957) [Arabidopsis thaliana] Length = 383 Score = 25.8 bits (54), Expect = 5.4 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +3 Query: 3 SIKMKIYKDIITGDEMFSDTYKMKLVDEVIYEVTG 107 S+ K Y+D+I+ E+F ++ + V+Y G Sbjct: 56 SLISKAYRDLISSPELFQTRSRLGFTEPVLYTSIG 90 >At1g53210.1 68414.m06031 sodium/calcium exchanger family protein / calcium-binding EF hand family protein contains Pfam profiles: PF01699 sodium/calcium exchanger protein, PF00036 EF hand Length = 585 Score = 25.8 bits (54), Expect = 5.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 86 FIDQFHFVSVREHLITSDN 30 F+D FH + REH + DN Sbjct: 392 FLDNFHVQTKREHALLGDN 410 >At5g49070.1 68418.m06072 beta-ketoacyl-CoA synthase family protein similar to very-long-chain fatty acid condensing enzyme CUT1 [GI:5001734], beta-ketoacyl-CoA synthase [Simmondsia chinensis][GI:1045614] Length = 464 Score = 25.4 bits (53), Expect = 7.1 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -2 Query: 152 KTLDLDITLCSRHQPTGHFVNNFIDQFHFVS 60 +++D+ IT CS H P+ I++FH S Sbjct: 145 RSIDILITNCSLHSPSPSLSAMVINKFHMRS 175 >At4g19500.1 68417.m02868 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. A false intron was added between exons 2 and 3 to circumvent a frameshift caused by a sequencing error, as per Blake Meyers (bcmeyers@vegmail.ucdavis.edu) Length = 1308 Score = 25.0 bits (52), Expect = 9.4 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -2 Query: 71 HFVSVREHLITSDNVLIDLHF 9 H V+V EH T+D V+I ++F Sbjct: 648 HLVAVMEHWKTTDLVIIPIYF 668 >At4g13920.1 68417.m02154 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 891 Score = 25.0 bits (52), Expect = 9.4 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = -2 Query: 218 DYVNSALDGRVRALVSLFS-RRIKTLDLDIT--LCSRHQPTGHF 96 D NS L+GR+R+ SLF + +++LDL C+ +G+F Sbjct: 85 DLGNSDLNGRLRSNSSLFRLQHLQSLDLSYNDLSCTLPDSSGNF 128 >At4g01660.1 68417.m00216 ABC1 family protein contains Pfam domain, PF03109: ABC1 family Length = 623 Score = 25.0 bits (52), Expect = 9.4 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 3/77 (3%) Frame = +3 Query: 63 YKMKLVDEVIYEVTGRLVTRAQGDIQIE---GFNPSAEEADEGTDSAVESGVDIVLNHRL 233 Y K VD+ + V ++G I++ GF + +E+D D+ V++G + L Sbjct: 479 YPKKFVDDYLRMVMACAEKDSEGVIEMSRRLGFL-TGDESDVMLDAHVQAGFIVGLPFAE 537 Query: 234 VETYAFGTRNPTHCLKN 284 YAF T N + N Sbjct: 538 PGGYAFRTNNIASSISN 554 >At3g17800.1 68416.m02270 expressed protein Length = 421 Score = 25.0 bits (52), Expect = 9.4 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +3 Query: 138 QIEGFNPSAEEADEGTDSAVESGVDIVLNHRLVE 239 Q+E + + DSA G DIVL R+ E Sbjct: 123 QLEQLQTDRDSQGQNKDSASVPGTDIVLYRRIAE 156 >At1g50420.1 68414.m05651 scarecrow-like transcription factor 3 (SCL3) identical to GB:AAD24404 GI:4580515 from [Arabidopsis thaliana] (Plant J. 18 (1), 111-119 (1999)) Length = 482 Score = 25.0 bits (52), Expect = 9.4 Identities = 11/39 (28%), Positives = 17/39 (43%) Frame = +3 Query: 168 EADEGTDSAVESGVDIVLNHRLVETYAFGTRNPTHCLKN 284 + D GT S S + + L + +P HCLK+ Sbjct: 6 QEDNGTSSVASSPLQVFSTMSLNRPTLLASSSPFHCLKD 44 >At1g50200.1 68414.m05629 aminoacyl-tRNA synthetase family protein contains Pfam profiles: PF01411 tRNA synthetases class II (A), PF02272 DHHA1 domain Length = 1003 Score = 25.0 bits (52), Expect = 9.4 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = +3 Query: 33 ITGDEMFS--DTYKMKL-VDEVIYEVTGRLVTRAQGDIQIEGFNPSAEEADEGTDSA 194 ++GD+ F DTY L + +++ E G LV ++GFN + EEA E + SA Sbjct: 458 LSGDDAFILWDTYGFPLDLTQLMAEERGLLV-------DVDGFNKAMEEARERSRSA 507 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,985,625 Number of Sequences: 28952 Number of extensions: 101639 Number of successful extensions: 271 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 267 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 268 length of database: 12,070,560 effective HSP length: 70 effective length of database: 10,043,920 effective search space used: 291273680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -