BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30190 (706 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) 103 1e-22 SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) 33 0.17 SB_25386| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.91 SB_56046| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_14545| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_42068| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_49736| Best HMM Match : Fibrinogen_C (HMM E-Value=2.3e-10) 29 4.9 SB_42582| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_34720| Best HMM Match : Fibrinogen_C (HMM E-Value=7.8e-13) 29 4.9 SB_22029| Best HMM Match : Copine (HMM E-Value=3.6e-24) 29 4.9 SB_50149| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 >SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) Length = 322 Score = 103 bits (248), Expect = 1e-22 Identities = 43/64 (67%), Positives = 55/64 (85%) Frame = +1 Query: 511 QISNGYTPVLDCHTAHIACKFAEIKEKVDRRTGKSTEVNPKSIKSGDAAIVNLVPSKPLC 690 +I GY+PVLDCHTAHIACKF ++ EK+DRR+GK E NPK IK+GDAA+V ++PSKP+C Sbjct: 211 EIHAGYSPVLDCHTAHIACKFDKLLEKIDRRSGKKLEDNPKMIKTGDAAMVEMIPSKPMC 270 Query: 691 VESF 702 VE+F Sbjct: 271 VETF 274 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +2 Query: 446 KNNPPKGAADFTAQVIVLNHP 508 KNNPPK FTAQVIV+NHP Sbjct: 189 KNNPPKPCKSFTAQVIVMNHP 209 >SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) Length = 547 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 592 VDRRTGKSTEVNPKSIKSGDAAIVNLVPSKPLCVESF 702 +D++TGK + P+ IK AI L +C+E F Sbjct: 496 IDKKTGKKGQTRPRFIKQDQIAIARLETQGVICIEKF 532 >SB_25386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 695 Score = 31.1 bits (67), Expect = 0.91 Identities = 16/43 (37%), Positives = 28/43 (65%) Frame = +1 Query: 556 HIACKFAEIKEKVDRRTGKSTEVNPKSIKSGDAAIVNLVPSKP 684 HIA K E+K D ++ K+ ++ PK++ SGD ++VP++P Sbjct: 74 HIAKKL-EVK---DSQSSKNNDLYPKTVPSGDIGTDSVVPNQP 112 >SB_56046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 674 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/63 (28%), Positives = 33/63 (52%) Frame = -3 Query: 416 ALCLVGIVAASRPPGEAQLTSYENVHNGRGNYRFGYSQSDGTVFEQEGTLKNEGKKKNPW 237 A+ + G++A+ + + +L+ V G G +R+ S G +EG+L E KK W Sbjct: 322 AVAVAGVLASLKIT-KTRLSDQRIVFQGAGRHRYCKPASPG---HEEGSLTEEQAKKKIW 377 Query: 236 LLE 228 L++ Sbjct: 378 LVD 380 >SB_14545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 3/39 (7%) Frame = -2 Query: 204 DGVTYTVTF---VADEDGYQPEIEQGPGGAVPSAILHSL 97 DG T+T + D+DG+ PE+ PG + S++LHS+ Sbjct: 56 DGTTHTPNVCINLTDDDGFVPELPSLPG--MKSSLLHSM 92 >SB_42068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3367 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = -3 Query: 644 DLMDF--GLTSVDLPVRRSTFSL-ISANLQAMWAVWQS 540 DL +F G+T++ LP ST + NLQ W +WQS Sbjct: 2456 DLGNFIKGITTIPLPSSSSTPIIDFEVNLQGEWILWQS 2493 >SB_49736| Best HMM Match : Fibrinogen_C (HMM E-Value=2.3e-10) Length = 98 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -2 Query: 642 LDGFWVDFSRFTSTTVNFFFDFCKFAGNVGSVAIQHW 532 L G W F R +V+F+ D+ ++ G + +HW Sbjct: 8 LGGGWTVFQRRQDGSVDFWRDWAEYKNGFGDLQGEHW 44 >SB_42582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 939 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -2 Query: 642 LDGFWVDFSRFTSTTVNFFFDFCKFAGNVGSVAIQHW 532 L G W F R +V+F+ D+ ++ G + +HW Sbjct: 250 LGGGWTVFQRRQDGSVDFWRDWAEYKNGFGDLQGEHW 286 >SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4529 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -1 Query: 577 LQICRQCGQCGNPTLVCNRLRFDRMVKHNDLSCKICS 467 L +C QCGQC +P C ++ ++M+ C C+ Sbjct: 767 LIVCSQCGQCFHP--YCVGVKVNKMILSKGWRCLDCT 801 >SB_34720| Best HMM Match : Fibrinogen_C (HMM E-Value=7.8e-13) Length = 168 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -2 Query: 642 LDGFWVDFSRFTSTTVNFFFDFCKFAGNVGSVAIQHW 532 L G W F R +V+F+ D+ ++ G + +HW Sbjct: 8 LGGGWTVFQRRQDGSVDFWRDWAEYKNGFGDLQGEHW 44 >SB_22029| Best HMM Match : Copine (HMM E-Value=3.6e-24) Length = 726 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 577 EIKEKVDRRTGKSTEVNPKSIKSGDAAIVNLVPSKPLCVESFQ 705 EI R TG++TE+N ++ SG+ I +V + C+ Q Sbjct: 257 EINASHSRETGQTTEIN--ALHSGEPGIPGVVAAYQACIRQVQ 297 >SB_50149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 656 Score = 27.9 bits (59), Expect = 8.5 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Frame = +1 Query: 517 SNGYTPVLDCHTAHIACKFAEIKEKVDRRTGKSTEVNPKSIKSGDAAIVNLV-PSKP 684 +N P+L+ T +A K D T + +VN KS G +I+ P+ P Sbjct: 586 ANALNPLLEHRTEKVALSKPMSNGKEDLNTETTADVNKKSCADGSDSIIGTTDPNSP 642 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,056,066 Number of Sequences: 59808 Number of extensions: 525454 Number of successful extensions: 1388 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1388 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -