BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30188 (792 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein ... 165 1e-42 AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. 27 0.50 CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein ... 27 0.88 DQ212042-1|ABB00987.1| 102|Anopheles gambiae defensin protein. 25 2.7 AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox prote... 25 3.5 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 25 3.5 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 25 3.5 AY745224-1|AAU93491.1| 103|Anopheles gambiae cytochrome P450 pr... 24 4.7 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 24 6.2 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 24 6.2 AY330173-1|AAQ16279.1| 202|Anopheles gambiae odorant-binding pr... 23 8.2 AJ618917-1|CAF01996.1| 199|Anopheles gambiae putative odorant-b... 23 8.2 >AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein L8 protein. Length = 261 Score = 165 bits (401), Expect = 1e-42 Identities = 75/85 (88%), Positives = 79/85 (92%) Frame = +3 Query: 510 EKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDK 689 EK GDRG+LAR SGN+A+VI HNPD KRTRVKLPSGAKKVLPS+NR MVGIVAGGGRIDK Sbjct: 118 EKTGDRGKLARTSGNYASVIAHNPDTKRTRVKLPSGAKKVLPSANRAMVGIVAGGGRIDK 177 Query: 690 PILKAGRAYHKYKVKRNCWPYVRGV 764 PILKAGRAYHKYKVKRNCWP VRGV Sbjct: 178 PILKAGRAYHKYKVKRNCWPKVRGV 202 Score = 91.9 bits (218), Expect = 2e-20 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = +2 Query: 254 LDYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEG 403 LDYAERHGY+KGVVK II DPGRGAPLAVV+FRDPY+F+ K+LFIA EG Sbjct: 32 LDYAERHGYLKGVVKQIIQDPGRGAPLAVVNFRDPYRFRLSKQLFIAAEG 81 Score = 72.5 bits (170), Expect = 1e-14 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = +1 Query: 403 LYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLERK 516 +YTGQFVYCG++A L++GNV+P+G MPEGTIVCNLE K Sbjct: 82 MYTGQFVYCGRRAQLQIGNVIPIGLMPEGTIVCNLEEK 119 Score = 58.4 bits (135), Expect = 2e-10 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 162 MGRVIRAQRKGAGSVFVSHTKKRKGAPKLR 251 MGRVIRAQRKGAGSVF +HTKKRKG PKLR Sbjct: 1 MGRVIRAQRKGAGSVFRAHTKKRKGQPKLR 30 Score = 25.8 bits (54), Expect = 1.5 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2 Query: 764 AMNPVEHPH 790 AMNPVEHPH Sbjct: 203 AMNPVEHPH 211 >AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. Length = 144 Score = 27.5 bits (58), Expect = 0.50 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +3 Query: 636 SSNRGMVGIVAGGGRIDKPILKAGRAYHK 722 S+ + +G V GG D IL GRAYH+ Sbjct: 81 SAGQVPLGAVVGGHTSDGEILYVGRAYHE 109 >CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein protein. Length = 196 Score = 26.6 bits (56), Expect = 0.88 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +1 Query: 334 GCCTLPRSIQVQDKEGALHCSRRLYTGQFVYCGKKATLE 450 GCC LP + Q K+ + + + R T F Y +++ +E Sbjct: 16 GCCALPANTNAQTKQDSSNNNNRT-TELFAYPAEQSAIE 53 >DQ212042-1|ABB00987.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.0 bits (52), Expect = 2.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 340 CTLPRSIQVQDKEGALHCSRRLYTGQFVYCGKKA 441 C L R V A HC R Y G YC KA Sbjct: 65 CDLARGFGVGSSLCAAHCIARRYRGG--YCNSKA 96 >AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox protein protein. Length = 338 Score = 24.6 bits (51), Expect = 3.5 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = +2 Query: 638 KQQRHGRYCCWRWTY 682 +QQ+HG++CC R ++ Sbjct: 280 QQQQHGQHCCCRGSH 294 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.6 bits (51), Expect = 3.5 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +2 Query: 269 RHGYIKGVVKDIIHDP 316 R+ +K ++KDI+HDP Sbjct: 737 RYTMLKDMIKDIMHDP 752 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.6 bits (51), Expect = 3.5 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +2 Query: 269 RHGYIKGVVKDIIHDP 316 R+ +K ++KDI+HDP Sbjct: 737 RYTMLKDMIKDIMHDP 752 >AY745224-1|AAU93491.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 24.2 bits (50), Expect = 4.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 344 HFRDPYKFKTRKELFIAPEGSTQA 415 HF DPYK+ ++ F A G ++A Sbjct: 28 HFADPYKYDPKR--FAAENGGSKA 49 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.8 bits (49), Expect = 6.2 Identities = 15/62 (24%), Positives = 26/62 (41%) Frame = -1 Query: 486 LRHSSNRHHISNFKSCFLSTINKLACVEPSGAMKSSFLVLNLYGSRKCTTAKGAPLPGSW 307 +RH +++ SCFL +N + +G S L+L S A + P S Sbjct: 177 MRHYVPHISLNSSSSCFLDVLNLHELYQLNGVHNHSNHYLDLVLSNSAAAACSSVYPASS 236 Query: 306 II 301 ++ Sbjct: 237 LL 238 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 23.8 bits (49), Expect = 6.2 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -1 Query: 519 PFSLKIAHNGTLRHSSNRHHISNF 448 P S ++ H G +RH+ R+ + F Sbjct: 218 PSSPRMRHQGRIRHADRRYKATQF 241 >AY330173-1|AAQ16279.1| 202|Anopheles gambiae odorant-binding protein AgamOBP46 protein. Length = 202 Score = 23.4 bits (48), Expect = 8.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 475 AMPEGTIVCNLERKWVIEVV 534 A P+GT VCN E ++++ + Sbjct: 147 ATPKGTQVCNPEASFLVDCI 166 >AJ618917-1|CAF01996.1| 199|Anopheles gambiae putative odorant-binding protein OBPjj1 protein. Length = 199 Score = 23.4 bits (48), Expect = 8.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 475 AMPEGTIVCNLERKWVIEVV 534 A P+GT VCN E ++++ + Sbjct: 144 ATPKGTQVCNPEASFLVDCI 163 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 896,177 Number of Sequences: 2352 Number of extensions: 19590 Number of successful extensions: 52 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83160600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -