BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30188 (792 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 25 0.61 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 4.3 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 4.3 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 4.3 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 4.3 AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 22 5.7 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 7.5 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 25.4 bits (53), Expect = 0.61 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 346 LPRSIQVQDKEGALHCSRRLYTGQFVYCGK 435 L +S++ DKE L LY +F Y GK Sbjct: 508 LNKSLKYSDKERDLSLRMILYFSEFAYLGK 537 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 22.6 bits (46), Expect = 4.3 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 516 FSLKIAHNGTLRHSSNRHHI 457 F+L+I NGT+ + RH I Sbjct: 164 FALRIYRNGTVNYLMRRHLI 183 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 22.6 bits (46), Expect = 4.3 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 516 FSLKIAHNGTLRHSSNRHHI 457 F+L+I NGT+ + RH I Sbjct: 164 FALRIYRNGTVNYLMRRHLI 183 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 22.6 bits (46), Expect = 4.3 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 516 FSLKIAHNGTLRHSSNRHHI 457 F+L+I NGT+ + RH I Sbjct: 215 FALRIYRNGTVNYLMRRHLI 234 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 22.6 bits (46), Expect = 4.3 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 516 FSLKIAHNGTLRHSSNRHHI 457 F+L+I NGT+ + RH I Sbjct: 164 FALRIYRNGTVNYLMRRHLI 183 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 22.2 bits (45), Expect = 5.7 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 567 IGHNPDAKRTRVKLPSGAKKVL 632 IG+ + K+TR LP+G +KVL Sbjct: 57 IGYGSN-KKTRHMLPTGFRKVL 77 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.8 bits (44), Expect = 7.5 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 773 GSWHTTYIWPAVTFDLV 723 G H TY+ PAVT L+ Sbjct: 253 GILHATYVIPAVTMMLL 269 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 230,601 Number of Sequences: 438 Number of extensions: 5125 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25003662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -