BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30187 (402 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1333| Best HMM Match : IncA (HMM E-Value=0.32) 28 3.3 SB_49202| Best HMM Match : Herpes_UL1 (HMM E-Value=3.2) 27 4.3 SB_50604| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_43579| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 10.0 >SB_1333| Best HMM Match : IncA (HMM E-Value=0.32) Length = 302 Score = 27.9 bits (59), Expect = 3.3 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 139 CSASNRLIHAKD--HASVQLVIADVDPATGRAADTSKMYVVVGLS 267 C A + +H D HA Q++ A +DP TG S V + LS Sbjct: 38 CRAPHGRVHRGDDHHAKSQILTAKLDPLTGEIVLVSTGIVFLSLS 82 >SB_49202| Best HMM Match : Herpes_UL1 (HMM E-Value=3.2) Length = 304 Score = 27.5 bits (58), Expect = 4.3 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -1 Query: 294 MQSSDSPIFG*PHNNIHFRCVSSTTCGGVY 205 M P+F P +N++ CV+ T G V+ Sbjct: 57 MHLQPDPLFSIPSDNVYMTCVTGTILGRVF 86 >SB_50604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 26.6 bits (56), Expect = 7.6 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = -2 Query: 311 SLLTSRCNHQTLPSSDSPTTTYILDVSAARPVAGSTSAITSCTE 180 ++LTS + +++PSS S T I +S+A S A+T T+ Sbjct: 16 TVLTSASSSESVPSSGSSATLIIDQLSSASSSRFSDVAVTLSTD 59 >SB_43579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 26.2 bits (55), Expect = 10.0 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 154 RLIHAKDHASVQLVIADVDPATGR 225 R+ H +HA Q++ A +DP TG+ Sbjct: 44 RVHHGINHAKSQILTAKLDPLTGK 67 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,768,597 Number of Sequences: 59808 Number of extensions: 141374 Number of successful extensions: 490 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 490 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 715479706 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -