BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30187 (402 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457553-1|AAL68783.1| 178|Anopheles gambiae mucin-like protein... 24 1.8 AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 23 3.2 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 4.2 AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 22 7.3 AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase... 22 7.3 AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 22 9.6 >AF457553-1|AAL68783.1| 178|Anopheles gambiae mucin-like protein protein. Length = 178 Score = 24.2 bits (50), Expect = 1.8 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = -2 Query: 302 TSRCNHQTLPSSDSPTTTYILDVSAARPVAGSTSAITSCTEAWSL 168 T+ QT SSD+ TTT + +A A T+A +S T S+ Sbjct: 109 TTTTEAQTTSSSDNSTTT---EAAATTTAASETTADSSSTGTTSV 150 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 23.4 bits (48), Expect = 3.2 Identities = 14/57 (24%), Positives = 23/57 (40%) Frame = -2 Query: 263 SPTTTYILDVSAARPVAGSTSAITSCTEAWSLAWMRRLLAEHFLGQYKSTNSPASFC 93 SPT Y S+ + + I+SC + +M R + FLG + + C Sbjct: 492 SPTFVYQYVNSSGIALVQLMAYISSCCNPITYCFMNRRFRQAFLGVFSCYRNRMPIC 548 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.0 bits (47), Expect = 4.2 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 299 SRCNHQTLPSSDSPTTTYILDVSAARPVAGSTS 201 SRC+ ++ S+ PT + S++ A STS Sbjct: 777 SRCSKPSVTSTTPPTPASLSSSSSSSSSASSTS 809 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 22.2 bits (45), Expect = 7.3 Identities = 17/55 (30%), Positives = 22/55 (40%) Frame = -3 Query: 271 LRIAPQQHTF*MCQQHDLWRGLRQQSLAVLKHGP*RG*GGCWPSISSGSTSQRIH 107 L+ A Q H+ QQ G +Q S G G GG SSG+ +H Sbjct: 222 LKSAQQHHSQKQAQQEHTVVGSQQTSNGGGTGGGTGGSGGAGSGGSSGNLGSHLH 276 >AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase subunit 2 protein. Length = 686 Score = 22.2 bits (45), Expect = 7.3 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 101 TPVNSLTCTARGNARPATASSTLR 172 T V SLT RGN AT+ +R Sbjct: 654 TAVRSLTDFTRGNTNMATSQVQIR 677 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 21.8 bits (44), Expect = 9.6 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 98 TTPVNSLTCTARGNARPATASSTLRTMLQY 187 +T V +LT ARG + + TLR ++Y Sbjct: 130 STVVTALTNGARGANKKLSKVDTLRLAVEY 159 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 297,214 Number of Sequences: 2352 Number of extensions: 5173 Number of successful extensions: 14 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32067225 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -