BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30187 (402 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00033-12|AAC48297.2| 88|Caenorhabditis elegans Ribosomal prot... 73 6e-14 Z70208-11|CAA94144.1| 598|Caenorhabditis elegans Hypothetical p... 30 0.54 Z73103-3|CAA97423.1| 540|Caenorhabditis elegans Hypothetical pr... 27 6.7 U39849-10|AAA81054.3| 951|Caenorhabditis elegans Glutamate rece... 27 6.7 >U00033-12|AAC48297.2| 88|Caenorhabditis elegans Ribosomal protein, small subunitprotein 21 protein. Length = 88 Score = 73.3 bits (172), Expect = 6e-14 Identities = 35/58 (60%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +1 Query: 91 MQNDAGEFVDLYCPRKCSASNRLIHAKDHASVQLVIADVDPATGR-AADTSKMYVVVG 261 MQNDAG+ V+LY PRKCS+SNR+I KDHASVQ+ DVDP TGR S Y + G Sbjct: 1 MQNDAGQTVELYVPRKCSSSNRIIGPKDHASVQIDFVDVDPETGRMIPGKSTRYAICG 58 Score = 32.7 bits (71), Expect = 0.10 Identities = 12/22 (54%), Positives = 19/22 (86%) Frame = +2 Query: 269 KMGESDDCIVRLTKKDGILAKN 334 +MGESDD I+RL +KDG++ ++ Sbjct: 62 RMGESDDAILRLAQKDGLVPRD 83 >Z70208-11|CAA94144.1| 598|Caenorhabditis elegans Hypothetical protein F54B11.11 protein. Length = 598 Score = 30.3 bits (65), Expect = 0.54 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = -2 Query: 311 SLLTSRCNHQTLPSSDSPTTTYILDVSAARPVAGSTSAITSCT 183 ++LT+ T P + +P TT+I V PV ST+ +S T Sbjct: 499 NILTTTATTTTPPVTSAPATTFITPVPFTPPVTNSTTIYSSNT 541 >Z73103-3|CAA97423.1| 540|Caenorhabditis elegans Hypothetical protein C08F8.4 protein. Length = 540 Score = 26.6 bits (56), Expect = 6.7 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -2 Query: 176 WSLAWMRRLLAEHFLGQYKS 117 W++AW+RR++ E G Y++ Sbjct: 359 WTVAWLRRVVYERVEGPYRT 378 >U39849-10|AAA81054.3| 951|Caenorhabditis elegans Glutamate receptor family (ampa)protein 4 protein. Length = 951 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -3 Query: 292 AIIRLSHLRIAPQQHTF*MCQQHDLW 215 +I R+ L AP+Q + MC HD+W Sbjct: 302 SIYRMRELGHAPRQSSI-MCDSHDIW 326 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,469,144 Number of Sequences: 27780 Number of extensions: 108110 Number of successful extensions: 393 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 366 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 393 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 630384202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -