BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30187 (402 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g53890.1 68416.m05953 40S ribosomal protein S21 (RPS21B) ribo... 60 4e-10 At5g27700.1 68418.m03322 40S ribosomal protein S21 (RPS21C) ribo... 59 1e-09 At5g20070.1 68418.m02390 MutT/nudix family protein low similarit... 27 4.7 At5g58220.1 68418.m07289 expressed protein 26 8.2 >At3g53890.1 68416.m05953 40S ribosomal protein S21 (RPS21B) ribosomal protein S21, cytosolic - Oryza sativa, PIR:S38357 Length = 82 Score = 60.5 bits (140), Expect = 4e-10 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 91 MQNDAGEFVDLYCPRKCSASNRLIHAKDHASVQLVIADVD 210 M+NDAG+ +LY PRKCSA+NR+I +KDHASVQL I +D Sbjct: 1 MENDAGQVTELYIPRKCSATNRMITSKDHASVQLNIGHLD 40 >At5g27700.1 68418.m03322 40S ribosomal protein S21 (RPS21C) ribosomal protein S21, Zea mays, PIR:T03945 Length = 85 Score = 58.8 bits (136), Expect = 1e-09 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +1 Query: 91 MQNDAGEFVDLYCPRKCSASNRLIHAKDHASVQLVIADVD 210 MQN+ G+ +LY PRKCSA+NRLI +KDHASVQL I +D Sbjct: 1 MQNEEGQVTELYIPRKCSATNRLITSKDHASVQLNIGHLD 40 >At5g20070.1 68418.m02390 MutT/nudix family protein low similarity to SP|Q19427 NADH pyrophosphatase (EC 3.6.1.-) {Caenorhabditis elegans}; contains Pfam profile PF00293: NUDIX domain Length = 438 Score = 27.1 bits (57), Expect = 4.7 Identities = 11/41 (26%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 278 LPSSDSPTTTY-ILDVSAARPVAGSTSAITSCTEAWSLAWM 159 +P+ +P+ + +L S RP+ S+ + T W L W+ Sbjct: 77 IPNHSTPSPDFKVLPFSKGRPLVFSSGGDANTTPIWHLGWV 117 >At5g58220.1 68418.m07289 expressed protein Length = 324 Score = 26.2 bits (55), Expect = 8.2 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 269 SDSPTTTYILDVSAARPVAG 210 S P TT++LDVS P AG Sbjct: 202 SRPPITTHVLDVSRGAPAAG 221 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,021,985 Number of Sequences: 28952 Number of extensions: 98533 Number of successful extensions: 269 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 269 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 269 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 585758608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -