BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30183 (661 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8962| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_10664| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_6681| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_16008| Best HMM Match : Orn_Arg_deC_N (HMM E-Value=6.6e-09) 29 2.5 SB_27753| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_31039| Best HMM Match : Fibrinogen_C (HMM E-Value=4.2e-39) 28 7.7 >SB_8962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 41.1 bits (92), Expect = 8e-04 Identities = 19/41 (46%), Positives = 23/41 (56%) Frame = +3 Query: 510 LDQRVPYLIEVMFQVWKDGFKDHPAXXXXXXXXXXXXQFTH 632 +++RV Y+IEVMF V KDGFKDH Q TH Sbjct: 27 IERRVEYMIEVMFAVRKDGFKDHVTIPEGLDLVEEEDQITH 67 >SB_10664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 30.7 bits (66), Expect = 1.1 Identities = 10/19 (52%), Positives = 17/19 (89%) Frame = +1 Query: 277 KSICISSASFIAHLVNQRV 333 K++C+++ F+AHLVNQ+V Sbjct: 28 KTVCLTTTRFVAHLVNQQV 46 >SB_6681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = +2 Query: 152 SPTFTNVYAALVSAVNSRFPNIGELLLKRLVIQFKEVLNA 271 SPT+ + AL AV FP+ G + K+LV +F + LNA Sbjct: 9 SPTYQDYVNALKKAVPQLFPDQG--VFKQLVTEFGQSLNA 46 >SB_16008| Best HMM Match : Orn_Arg_deC_N (HMM E-Value=6.6e-09) Length = 314 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = +2 Query: 152 SPTFTNVYAALVSAVNSRFPNIGELLLKRLVIQFKEVLNA 271 SPT+ + AL AV FP+ G + K+LV +F + LNA Sbjct: 210 SPTYQDYVNALKKAVPQLFPDQG--VFKQLVTEFGQSLNA 247 >SB_27753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 568 NPSFQTWNITSIRYGTLWSNDLH 500 NP QTW+ S Y WS+D H Sbjct: 29 NPYLQTWSFYSYPYLQTWSHDSH 51 >SB_31039| Best HMM Match : Fibrinogen_C (HMM E-Value=4.2e-39) Length = 411 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 291 FLCIFHCTFSESESGT*DSGFRTSH 365 FLC+F FS+S GT + T H Sbjct: 12 FLCLFRMAFSQSNDGTRSNYLATEH 36 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,356,743 Number of Sequences: 59808 Number of extensions: 312835 Number of successful extensions: 504 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -