BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30182 (625 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47057| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.94) 29 4.1 SB_33759| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_47057| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.94) Length = 969 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/49 (24%), Positives = 26/49 (53%) Frame = +1 Query: 382 MRPFKKNNVLTNTYRFSRFILRKRNVYIYYLLYMIERNNVKCNEIIMNL 528 +R +++ ++ TY + + V + Y Y ++ + V+C E+IM L Sbjct: 319 VRGGREHGGMSGTYHSLIPVTEREGVDVIYSTYEVDESTVECQEVIMML 367 >SB_33759| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +1 Query: 355 KNELIINLQMRPFKKNNVLTNTYRFSRFILRKRNVYIYYLLYMIERN 495 + + I+NLQ+ + + NTY R++LR + +LL +I+ + Sbjct: 81 ETQAIVNLQIDSGQVIEGIGNTYGHQRYLLRSLPIIEIFLLMVIQHS 127 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,933,992 Number of Sequences: 59808 Number of extensions: 289426 Number of successful extensions: 545 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 502 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1548368000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -