BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30181 (628 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 25 2.0 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 25 2.0 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 23 7.9 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 23 7.9 AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease pr... 23 7.9 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 25.0 bits (52), Expect = 2.0 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = +1 Query: 373 AQTGPMPTSMMAQNGPVQTQANGPQHSFPSIHNTSFFAG-QTADFNRTSSTTCLPLTRAT 549 A GP + ++ P + A FPSI N + + + DF+ TS+T L + Sbjct: 87 AAPGPSALPLSSRKSPTVSSAAALNSGFPSIANPNPRSPFRHLDFS-TSATAELRRNPSL 145 Query: 550 SRPKSCS 570 S P C+ Sbjct: 146 SAPDECA 152 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 25.0 bits (52), Expect = 2.0 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = +1 Query: 373 AQTGPMPTSMMAQNGPVQTQANGPQHSFPSIHNTSFFAG-QTADFNRTSSTTCLPLTRAT 549 A GP + ++ P + A FPSI N + + + DF+ TS+T L + Sbjct: 87 AAPGPSALPLSSRKSPTVSSAAALNSGFPSIANPNPRSPFRHLDFS-TSATAELRRNPSL 145 Query: 550 SRPKSCS 570 S P C+ Sbjct: 146 SAPDECA 152 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 23.0 bits (47), Expect = 7.9 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 445 EVRWPVSARDRSGPSSRSAWDRSGR 371 EV PVS S +S AWD S R Sbjct: 395 EVDEPVSNHSASHSASEQAWDLSCR 419 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +3 Query: 327 GRAGKHGRPPGQPHARPDRSHADLDDGPERSRAD 428 G G+ G +RP + H+ L GP+ D Sbjct: 535 GGGGREGSQEWNSRSRPPQQHSMLRTGPKSLAPD 568 >AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease protein. Length = 375 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = -1 Query: 349 RPCFPARPAASTCSETGSCGCLVSVLARSSFGLLHNEMGH 230 +PC A C CG ++ +L + F H++ H Sbjct: 28 KPCTTPNGTAGRCVRVRECGYVLDLLRKDLFA--HSDTVH 65 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 594,040 Number of Sequences: 2352 Number of extensions: 11268 Number of successful extensions: 36 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61050630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -