BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30181 (628 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g42950.1 68418.m05236 GYF domain-containing protein contains ... 33 0.16 At5g52730.1 68418.m06545 heavy-metal-associated domain-containin... 31 0.83 At4g12610.1 68417.m01987 transcription initiation factor IIF alp... 30 1.4 At3g14270.1 68416.m01806 phosphatidylinositol-4-phosphate 5-kina... 29 2.5 At4g38550.1 68417.m05458 expressed protein 29 3.3 At1g60640.1 68414.m06826 expressed protein 29 3.3 At2g25010.1 68415.m02990 expressed protein 28 4.4 At5g51150.1 68418.m06342 expressed protein similar to unknown pr... 27 7.7 >At5g42950.1 68418.m05236 GYF domain-containing protein contains Pfam profile: PF02213 GYF domain Length = 1714 Score = 33.1 bits (72), Expect = 0.16 Identities = 24/80 (30%), Positives = 34/80 (42%), Gaps = 4/80 (5%) Frame = +3 Query: 210 LQVNSPLCPISLCNKPNDERARTDTKHPHEPVSEHVDAAGRAGKHGRPP---GQP-HARP 377 L P P++LC +DE D + VS + G GR P QP RP Sbjct: 328 LTSEEPTDPLALCAPSSDEVNVLDAIEKGKIVSSGAPQTSKDGPTGRNPVEFSQPRRIRP 387 Query: 378 DRSHADLDDGPERSRADTGQ 437 S D+ G E S+ ++G+ Sbjct: 388 AGSREDMTFGAEESKDESGE 407 >At5g52730.1 68418.m06545 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 185 Score = 30.7 bits (66), Expect = 0.83 Identities = 19/56 (33%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Frame = +3 Query: 252 KPNDERARTDTKHP-HEPVSEHVDAAGRAGK---HGRPPGQPHARPDRSHADLDDG 407 +P R+R + P EP A R + H RP PHARP R + DG Sbjct: 127 EPEQNRSRVTRREPSREPEPNRAPLARRESRPRTHSRP-SIPHARPSRVRGENSDG 181 >At4g12610.1 68417.m01987 transcription initiation factor IIF alpha subunit (TFIIF-alpha) family protein low similarity to SP|Q05913 Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) (Transcription factor 5, large chain) (TF5A) {Drosophila melanogaster}; contains Pfam profile PF05793: Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Length = 543 Score = 29.9 bits (64), Expect = 1.4 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +3 Query: 276 TDTKHPHEPVSEHVD-AAGRAGKHGRPPGQPHARPDRSHADLDDGPERSRADTGQR 440 T++K E VD A + G P G P A+P + L+DG + + + Q+ Sbjct: 377 TNSKQKEAAKEEPVDNAPAKPAPSGPPRGTPPAKPSKGKRKLNDGDSKKPSSSVQK 432 >At3g14270.1 68416.m01806 phosphatidylinositol-4-phosphate 5-kinase family protein similar to SP|Q9Z1T6 FYVE finger-containing phosphoinositide kinase (EC 2.7.1.68) (1- phosphatidylinositol-4-phosphate kinase) (PIP5K) (PtdIns(4)P-5-kinase) {Mus musculus}; contains Pfam profiles PF01504: Phosphatidylinositol-4-phosphate 5-Kinase, PF01363: FYVE zinc finger, PF00118: TCP-1/cpn60 chaperonin family Length = 1791 Score = 29.1 bits (62), Expect = 2.5 Identities = 19/59 (32%), Positives = 27/59 (45%) Frame = +2 Query: 434 PTDLNIRFPQFTTRLSLRDKLQTSTGLPRQHAFH*REQHHGPRAAQVYRQFVFERHPIS 610 PT L+ PQ + + + L T+T L Q G +A ++ FVF RH IS Sbjct: 699 PTMLSCAEPQRANSVPVSELLSTTTNLSIQKDIPPIPYGSGWQAREINPSFVFSRHNIS 757 >At4g38550.1 68417.m05458 expressed protein Length = 612 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +3 Query: 333 AGKHGRPPGQPHARPD--RSHADLDD 404 A H PP QP+ PD RSH D +D Sbjct: 285 AASHSPPPPQPYRTPDHRRSHQDNED 310 >At1g60640.1 68414.m06826 expressed protein Length = 340 Score = 28.7 bits (61), Expect = 3.3 Identities = 17/63 (26%), Positives = 26/63 (41%) Frame = +3 Query: 276 TDTKHPHEPVSEHVDAAGRAGKHGRPPGQPHARPDRSHADLDDGPERSRADTGQRTSTFV 455 +D + SE D+ + G G + AD+DDG + S AD T + Sbjct: 27 SDPETEESEQSEEEDSVAEVSEDGDDSGDDESPAAGEDADVDDGDDNSDADDYGGTLEKM 86 Query: 456 SLN 464 S+N Sbjct: 87 SMN 89 >At2g25010.1 68415.m02990 expressed protein Length = 509 Score = 28.3 bits (60), Expect = 4.4 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = -1 Query: 388 WDRSGR-AWGCPGGRPCFPARPAASTCSETGSCGCLVSVLARSSFGL 251 +D++GR AWG + A AS S++ CGCL + S F L Sbjct: 208 FDQAGRYAWGAAALACLYRALGNASLKSQSNICGCLTLLQCWSYFHL 254 >At5g51150.1 68418.m06342 expressed protein similar to unknown protein (gb|AAD46013.1) Length = 531 Score = 27.5 bits (58), Expect = 7.7 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 Query: 531 KACCRGSPVEVCSLS 487 + CCRG P++V SLS Sbjct: 262 RECCRGGPIDVASLS 276 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,203,720 Number of Sequences: 28952 Number of extensions: 221471 Number of successful extensions: 785 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 784 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -