BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30180X (360 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 1.9 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 1.9 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 2.5 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 5.9 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 5.9 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 20 7.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 20 7.7 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 22.2 bits (45), Expect = 1.9 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = +3 Query: 36 FKILFLDNFRGRQTEISAVVNSGY 107 +K ++ +++ ISA ++SGY Sbjct: 319 YKYKYIREIMNKESRISAAIDSGY 342 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.2 bits (45), Expect = 1.9 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = +3 Query: 36 FKILFLDNFRGRQTEISAVVNSGY 107 +K ++ +++ ISA ++SGY Sbjct: 319 YKYKYIREIMNKESRISAAIDSGY 342 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.8 bits (44), Expect = 2.5 Identities = 12/52 (23%), Positives = 22/52 (42%), Gaps = 7/52 (13%) Frame = -1 Query: 222 HENTLFDNHQKFYWTI-------LIASCPCLISDEPPEKLYPQLSCNHYLPR 88 + N +N++K Y+ I + P + PP + P +S +PR Sbjct: 340 YNNNYNNNYKKLYYNINYIEQIPVPVPVPIYCGNFPPRSMEPWISMQEQIPR 391 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 20.6 bits (41), Expect = 5.9 Identities = 5/19 (26%), Positives = 14/19 (73%) Frame = -1 Query: 225 MHENTLFDNHQKFYWTILI 169 +++NT+ +N+Q+ W+ + Sbjct: 379 LYQNTMSNNNQRTEWSATV 397 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 20.6 bits (41), Expect = 5.9 Identities = 5/19 (26%), Positives = 14/19 (73%) Frame = -1 Query: 225 MHENTLFDNHQKFYWTILI 169 +++NT+ +N+Q+ W+ + Sbjct: 417 LYQNTMSNNNQRTEWSATV 435 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 20.2 bits (40), Expect = 7.7 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 69 RQTEISAVVNSGYKIIVGII 128 R ++ AVV YK+ V +I Sbjct: 120 RDVQVRAVVAQAYKVDVEVI 139 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 20.2 bits (40), Expect = 7.7 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 69 RQTEISAVVNSGYKIIVGII 128 R ++ AVV YK+ V +I Sbjct: 120 RDVQVRAVVAQAYKVDVEVI 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,627 Number of Sequences: 438 Number of extensions: 2332 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8432340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -