BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30178 (650 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F12.02c |p23fy||translationally controlled tumor protein ho... 79 7e-16 SPBC577.10 |||20S proteasome component beta 7|Schizosaccharomyce... 27 3.1 SPAC1B3.15c |||membrane transporter|Schizosaccharomyces pombe|ch... 26 4.1 SPBC776.10c |cog6||Golgi transport complex peripheral subunit Co... 26 5.4 SPAC22A12.09c |sap114||splicing factor Sap114|Schizosaccharomyce... 25 7.2 >SPAC1F12.02c |p23fy||translationally controlled tumor protein homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 168 Score = 78.6 bits (185), Expect = 7e-16 Identities = 40/80 (50%), Positives = 52/80 (65%) Frame = +3 Query: 255 YMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQFFTGESMDCDGMVAMMEYRDF 434 YMK + A+L+E P++V VF+ N +K IL FK+ F+ GESMD D MV +M YR+ Sbjct: 91 YMKAIKARLQESNPERVPVFEKNAIGFVKKILANFKDYDFYIGESMDPDAMVVLMNYRE- 149 Query: 435 DGTQIPIMMFFKHGLEEEKF 494 DG P M+FFK GL EKF Sbjct: 150 DGI-TPYMIFFKDGLVSEKF 168 Score = 70.1 bits (164), Expect = 3e-13 Identities = 39/85 (45%), Positives = 57/85 (67%), Gaps = 1/85 (1%) Frame = +1 Query: 1 ITGDEMFSDTYKMKLVDEVIYEVTGRLVTRAQG-DIQIEGFNPSAEEADEGTDSAVESGV 177 I+GDE+ SD Y +K VD+++YE ++VT QG D+ I G NPSAE+A+E + E+ Sbjct: 8 ISGDELVSDAYDLKEVDDIVYEADCQMVTVKQGGDVDI-GANPSAEDAEENAEEGTETVN 66 Query: 178 DIVLNHRLVETYAFGDKKSYTLYLK 252 ++V + RL T +F DKKSY Y+K Sbjct: 67 NLVYSFRLSPT-SF-DKKSYMSYIK 89 >SPBC577.10 |||20S proteasome component beta 7|Schizosaccharomyces pombe|chr 2|||Manual Length = 262 Score = 26.6 bits (56), Expect = 3.1 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +1 Query: 82 VTRAQGDIQIEGFNPSAEEADEGTDSAVESGVDIVLNHRLVETYAFGD 225 +T G Q + F PS E +E TD+ ++ V ++ V F D Sbjct: 6 LTEVWGKPQKDIFFPSGSEVEESTDAPIQRTVQPIVTGSSVLALKFAD 53 >SPAC1B3.15c |||membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 628 Score = 26.2 bits (55), Expect = 4.1 Identities = 10/20 (50%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = -3 Query: 450 VFAYHQSLYIPSWQPC-HHN 394 V A+ Q L++P W PC HN Sbjct: 336 VVAFTQGLFLPRWLPCIKHN 355 >SPBC776.10c |cog6||Golgi transport complex peripheral subunit Cog6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 675 Score = 25.8 bits (54), Expect = 5.4 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 195 VVQDYVNSALDGRVRALVSLFSRRIKTLDLDIT 97 V++D +NS LDG + + S R +T LD++ Sbjct: 341 VLEDQMNSLLDGSLYGICRPLSSRAQTSVLDLS 373 >SPAC22A12.09c |sap114||splicing factor Sap114|Schizosaccharomyces pombe|chr 1|||Manual Length = 481 Score = 25.4 bits (53), Expect = 7.2 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -1 Query: 374 ELKFLKPAEDVFHYFVHVCFKYFNLVR 294 + FLKP ++ YF+ + +Y +L+R Sbjct: 175 QFDFLKPNNALYPYFMRIVQQYTSLIR 201 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,627,887 Number of Sequences: 5004 Number of extensions: 52423 Number of successful extensions: 150 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 149 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -