BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30178 (650 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z79754-10|CAB02099.1| 181|Caenorhabditis elegans Hypothetical p... 93 1e-19 AF101316-3|AAC69232.2| 508|Caenorhabditis elegans Hypothetical ... 31 0.71 Z81072-15|CAB03026.2| 1262|Caenorhabditis elegans Hypothetical p... 28 5.0 Z81048-10|CAB02845.2| 1262|Caenorhabditis elegans Hypothetical p... 28 5.0 Z81491-5|CAB04021.1| 225|Caenorhabditis elegans Hypothetical pr... 28 6.6 >Z79754-10|CAB02099.1| 181|Caenorhabditis elegans Hypothetical protein F25H2.11 protein. Length = 181 Score = 93.5 bits (222), Expect = 1e-19 Identities = 44/90 (48%), Positives = 61/90 (67%), Gaps = 2/90 (2%) Frame = +1 Query: 4 TGDEMFSDTYKMKLVDEVIYEVTGRLVTRAQGDIQIEGFNPSAEEA--DEGTDSAVESGV 177 T DE+ SD++ MKLVD+++YE G+ V R +G+I + G NPSAEE D+G+D VE G+ Sbjct: 9 TDDELSSDSFPMKLVDDLVYEFKGKHVVRKEGEIVLAGSNPSAEEGAEDDGSDEHVERGI 68 Query: 178 DIVLNHRLVETYAFGDKKSYTLYLKDI*KN 267 DIVLNH+LVE + D + Y+K KN Sbjct: 69 DIVLNHKLVEMNCYEDASMFKAYIKKFMKN 98 Score = 56.0 bits (129), Expect = 2e-08 Identities = 32/88 (36%), Positives = 51/88 (57%), Gaps = 7/88 (7%) Frame = +3 Query: 249 QRYMKKLVAKLEEKAPDQVEV--FKTNMNKVMKDILG--RFKELQFFTGESMDC---DGM 407 +++MK ++ +E+ D+ +V FK + + +L RFK L FF GE +G Sbjct: 93 KKFMKNVIDHMEKNNRDKADVDAFKKKIQGWVVSLLAKDRFKNLAFFIGERAAEGAENGQ 152 Query: 408 VAMMEYRDFDGTQIPIMMFFKHGLEEEK 491 VA++EYRD DGT++P +M K + EEK Sbjct: 153 VAIIEYRDVDGTEVPTLMLVKEAIIEEK 180 >AF101316-3|AAC69232.2| 508|Caenorhabditis elegans Hypothetical protein F52F10.2 protein. Length = 508 Score = 31.1 bits (67), Expect = 0.71 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 332 FVHVCFKYFNLVRRLLFQFCY*FFHIS 252 F+++C +Y RR L FCY F IS Sbjct: 137 FIYLCIEYLPTGRRYLMMFCYILFDIS 163 >Z81072-15|CAB03026.2| 1262|Caenorhabditis elegans Hypothetical protein F30A10.10 protein. Length = 1262 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +1 Query: 118 FNPSAEEADEGTDSAVESG-VDIVLNH 195 F+PSA +ADE D A E G VD L H Sbjct: 1236 FSPSASQADETGDRAPERGFVDTALAH 1262 >Z81048-10|CAB02845.2| 1262|Caenorhabditis elegans Hypothetical protein F30A10.10 protein. Length = 1262 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +1 Query: 118 FNPSAEEADEGTDSAVESG-VDIVLNH 195 F+PSA +ADE D A E G VD L H Sbjct: 1236 FSPSASQADETGDRAPERGFVDTALAH 1262 >Z81491-5|CAB04021.1| 225|Caenorhabditis elegans Hypothetical protein D1086.5 protein. Length = 225 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 Query: 228 EILHIVPQRYMKKLVAKLEEKAPDQV 305 ++ H+ P Y +K + ++ EK PDQV Sbjct: 103 DVFHLGPMYYCEKTLKEVIEKTPDQV 128 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,370,698 Number of Sequences: 27780 Number of extensions: 283626 Number of successful extensions: 843 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 842 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -