BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30177 (745 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 1.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 1.7 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 7.0 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 22 7.0 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 21 9.2 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 469 LPLIFLLDSLITQRVVYYQRWQSVHLNKKM 558 LPLI +L+ V+ RW+S +L +M Sbjct: 1615 LPLIVATVALVVAVVIVALRWRSRYLGDRM 1644 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 469 LPLIFLLDSLITQRVVYYQRWQSVHLNKKM 558 LPLI +L+ V+ RW+S +L +M Sbjct: 1611 LPLIVATVALVVAVVIVALRWRSRYLGDRM 1640 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 7.0 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +1 Query: 415 FELWRTLRVPNKVTALNSLPLI 480 +E WR + PN V L+ P + Sbjct: 859 YEDWRHWKFPNLVEVLDEFPSV 880 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.8 bits (44), Expect = 7.0 Identities = 7/19 (36%), Positives = 15/19 (78%) Frame = +3 Query: 561 IDMSIQIDLNIIVSFKEYG 617 +D+++ +DL+I + +EYG Sbjct: 676 VDVTLPLDLHIQNAIREYG 694 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.4 bits (43), Expect = 9.2 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -2 Query: 348 LTPLNGMLFFNSLPSALSYNINT 280 L+P+ L+++ L S Y +NT Sbjct: 259 LSPMTNNLYYSPLSSRSLYYVNT 281 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,157 Number of Sequences: 438 Number of extensions: 3451 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -