BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30175 (719 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16350.1 68416.m02068 myb family transcription factor ; conta... 29 3.1 At2g43840.1 68415.m05449 UDP-glucoronosyl/UDP-glucosyl transfera... 28 7.2 At5g55200.1 68418.m06881 co-chaperone grpE protein, putative sim... 27 9.5 At2g43840.2 68415.m05450 UDP-glucoronosyl/UDP-glucosyl transfera... 27 9.5 At1g11280.3 68414.m01295 S-locus protein kinase, putative simila... 27 9.5 At1g11280.2 68414.m01294 S-locus protein kinase, putative simila... 27 9.5 At1g11280.1 68414.m01296 S-locus protein kinase, putative simila... 27 9.5 >At3g16350.1 68416.m02068 myb family transcription factor ; contains Pfam profile: PF00249 Myb-like DNA-binding domain Length = 387 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 214 RLMSVNDKRLDMFDWTALCTNWSTERTPSSVA 309 RL V ++L DW + N+ T RTP+ VA Sbjct: 145 RLFLVGLQKLGKGDWRGISRNYVTSRTPTQVA 176 >At2g43840.1 68415.m05449 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 449 Score = 27.9 bits (59), Expect = 7.2 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 6/62 (9%) Frame = +1 Query: 139 IDVMSDKTVDAVVRIF-LGPKYDCM---GRLMSVNDKRLDMFDW--TALCTNWSTERTPS 300 +D+ ++ + V + +GP M ++ S ND L++FD ALCT+W +R Sbjct: 205 LDLHEEELLSKVCPVLTIGPTVPSMYLDQQIKSDNDYDLNLFDLKEAALCTDWLDKRPEG 264 Query: 301 SV 306 SV Sbjct: 265 SV 266 >At5g55200.1 68418.m06881 co-chaperone grpE protein, putative similar to chaperone GrpE type 2 [Nicotiana tabacum] GI:3851640; contains Pfam profile PF01025: co-chaperone GrpE Length = 302 Score = 27.5 bits (58), Expect = 9.5 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = -1 Query: 443 LRESVARLAPPVLDHCLAISGRHHFAFHYTTSRKVLWDKSLHIHGATDDGVL 288 LR S + + P + ++ R H H T ++ V SL HG D VL Sbjct: 16 LRSSFSSVVTPKRNQIPIVASRFHSLVHGTPNKLVAVPVSLRNHGTLDLNVL 67 >At2g43840.2 68415.m05450 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 449 Score = 27.5 bits (58), Expect = 9.5 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = +1 Query: 214 RLMSVNDKRLDMFDW--TALCTNWSTERTPSSV 306 ++ S ND L++FD ALCT+W +R SV Sbjct: 234 QIKSDNDYDLNLFDLKEAALCTDWLDKRPEGSV 266 >At1g11280.3 68414.m01295 S-locus protein kinase, putative similar to receptor protein kinase [Ipomoea trifida] gi|836954|gb|AAC23542; contains protein kinase domain, Pfam:PF00069; contains S-locus glycoprotein family domain, Pfam:PF00954 Length = 808 Score = 27.5 bits (58), Expect = 9.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 400 WSRTGGASLATDSLRDLCCPSVRLEVWRC 486 W TGG L + + C P V +EV RC Sbjct: 714 WLETGGVDLLDEDISSSCSP-VEVEVARC 741 >At1g11280.2 68414.m01294 S-locus protein kinase, putative similar to receptor protein kinase [Ipomoea trifida] gi|836954|gb|AAC23542; contains protein kinase domain, Pfam:PF00069; contains S-locus glycoprotein family domain, Pfam:PF00954 Length = 820 Score = 27.5 bits (58), Expect = 9.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 400 WSRTGGASLATDSLRDLCCPSVRLEVWRC 486 W TGG L + + C P V +EV RC Sbjct: 726 WLETGGVDLLDEDISSSCSP-VEVEVARC 753 >At1g11280.1 68414.m01296 S-locus protein kinase, putative similar to receptor protein kinase [Ipomoea trifida] gi|836954|gb|AAC23542; contains protein kinase domain, Pfam:PF00069; contains S-locus glycoprotein family domain, Pfam:PF00954 Length = 830 Score = 27.5 bits (58), Expect = 9.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 400 WSRTGGASLATDSLRDLCCPSVRLEVWRC 486 W TGG L + + C P V +EV RC Sbjct: 736 WLETGGVDLLDEDISSSCSP-VEVEVARC 763 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,933,418 Number of Sequences: 28952 Number of extensions: 383315 Number of successful extensions: 1178 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1177 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -