BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30174 (683 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0695 + 5730932-5731198 31 1.1 05_04_0286 + 19833114-19834053,19834149-19834165 29 2.6 08_01_0433 + 3794440-3794948,3795696-3796707 28 6.0 08_01_0661 - 5708088-5708131,5708217-5710048,5710527-5710625,571... 28 7.9 06_03_0893 - 25721576-25722205,25722366-25722443,25722628-25723560 28 7.9 04_03_1035 - 21887562-21890030 28 7.9 >11_01_0695 + 5730932-5731198 Length = 88 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 3/34 (8%) Frame = +1 Query: 334 ACVRRGGNCDHRPGDCCHSSSCRCNL---WGSNC 426 AC+ GG C RP DCC + C + +GS C Sbjct: 53 ACLPAGGFCMFRPMDCCGNCGCLYPVGVCYGSRC 86 >05_04_0286 + 19833114-19834053,19834149-19834165 Length = 318 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 325 FRRACVRRGGNCDHRPGDCCHSSSCRCNLWGSNCRC 432 F AC GG C H GD H C C W S C Sbjct: 251 FCGACRATGGVCGH-DGDS-HGDLCLCGDWNSTSNC 284 >08_01_0433 + 3794440-3794948,3795696-3796707 Length = 506 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 319 YVFRRACVRRGGNCDHRPGDCCHSSSCR 402 + RRAC RRGG C+ C S R Sbjct: 18 HALRRACWRRGGRCEPGWRSRCEGDSAR 45 >08_01_0661 - 5708088-5708131,5708217-5710048,5710527-5710625, 5711015-5711508,5711579-5711632,5712597-5712683, 5712684-5712776 Length = 900 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -2 Query: 592 RTGK*ERNGSVL-CWRMLWLPVERRSSRLLELVAASEELRSVSPTPTSGR 446 RTG +RNG CW+ L+LP++R + + + S+S + +GR Sbjct: 8 RTG--DRNGDASPCWKYLFLPLDRVQVSIFQAPVPTWLAGSISDSIQTGR 55 >06_03_0893 - 25721576-25722205,25722366-25722443,25722628-25723560 Length = 546 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 Query: 251 ASSLPDHRLRDQYKRHEPILL 189 A +LP H +RD +RH P++L Sbjct: 56 AGALPHHAMRDLARRHGPLML 76 >04_03_1035 - 21887562-21890030 Length = 822 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +1 Query: 370 PGDCCHSSSCRCNLW-GSNCRCQRMG 444 PG C S SC C +W GS C G Sbjct: 327 PGPCAPSKSCSCGVWSGSAQLCAGSG 352 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,237,802 Number of Sequences: 37544 Number of extensions: 294280 Number of successful extensions: 745 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 744 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -