BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30174 (683 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g39430.1 68418.m04776 hypothetical protein 29 3.8 At3g29180.1 68416.m03657 expressed protein 29 3.8 At5g47850.1 68418.m05912 protein kinase, putative contains simil... 28 5.0 At3g62680.1 68416.m07041 proline-rich family protein contains pr... 28 6.6 >At5g39430.1 68418.m04776 hypothetical protein Length = 511 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -1 Query: 389 EWQQSPGRWSQLPPRRTQARLKT*ISDDRFPTSCNNC 279 E QS G W ++PP + R +T D R + N C Sbjct: 241 EKHQSSGSWCEIPPSNLKLRGETYFKDKRKHPAPNQC 277 >At3g29180.1 68416.m03657 expressed protein Length = 513 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 383 QQSPGRWSQLPPRRTQARLKT*ISDDRFPTSCNNC 279 +QS G WS++PP + R +T D + + N C Sbjct: 246 KQSSGSWSEIPPSTFKLRGETYFKDKKKSPAPNQC 280 >At5g47850.1 68418.m05912 protein kinase, putative contains similarity to cytokinin-regulated kinase 1 [Nicotiana tabacum] gi|10998537|gb|AAG25966; contains protein kinase domain, Pfam:PF00069 Length = 751 Score = 28.3 bits (60), Expect = 5.0 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 Query: 543 CGFRWSGGQVGCW 505 CG RWS G V CW Sbjct: 237 CGVRWSNGTVVCW 249 >At3g62680.1 68416.m07041 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 313 Score = 27.9 bits (59), Expect = 6.6 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 512 PT*PPLHRKPQHSPTQNGPV 571 P+ PP+++ P+H PT PV Sbjct: 27 PSSPPVYKSPEHKPTLPSPV 46 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,893,537 Number of Sequences: 28952 Number of extensions: 215291 Number of successful extensions: 495 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 484 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 495 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -