BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30169X (455 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 22 2.4 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 21 4.1 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 21 5.5 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 22.2 bits (45), Expect = 2.4 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -2 Query: 439 TTQQKFHWTTKLIFVLSCA*KLGDSENSYPYY 344 T +Q W + VLS + N+YPYY Sbjct: 228 TLEQHRSWCSSSQPVLSTTNSTTNCYNNYPYY 259 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 21.4 bits (43), Expect = 4.1 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -1 Query: 287 RCDVLDRRSLH 255 R D+ DRRSLH Sbjct: 89 RMDIRDRRSLH 99 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.0 bits (42), Expect = 5.5 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -1 Query: 65 GDNHNLGHFVL 33 GD HN+GH ++ Sbjct: 360 GDFHNMGHILI 370 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,620 Number of Sequences: 336 Number of extensions: 754 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10406187 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -