SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV30169X
         (455 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ223614-1|CAA11490.1|  301|Tribolium castaneum orthodenticle-2 ...    22   2.4  
AF228509-1|AAF69136.1|  325|Tribolium castaneum prothoraxless pr...    21   4.1  
AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxida...    21   5.5  

>AJ223614-1|CAA11490.1|  301|Tribolium castaneum orthodenticle-2
           protein protein.
          Length = 301

 Score = 22.2 bits (45), Expect = 2.4
 Identities = 11/32 (34%), Positives = 15/32 (46%)
 Frame = -2

Query: 439 TTQQKFHWTTKLIFVLSCA*KLGDSENSYPYY 344
           T +Q   W +    VLS      +  N+YPYY
Sbjct: 228 TLEQHRSWCSSSQPVLSTTNSTTNCYNNYPYY 259


>AF228509-1|AAF69136.1|  325|Tribolium castaneum prothoraxless
           protein.
          Length = 325

 Score = 21.4 bits (43), Expect = 4.1
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = -1

Query: 287 RCDVLDRRSLH 255
           R D+ DRRSLH
Sbjct: 89  RMDIRDRRSLH 99


>AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxidase
           subunit 1 protein.
          Length = 682

 Score = 21.0 bits (42), Expect = 5.5
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -1

Query: 65  GDNHNLGHFVL 33
           GD HN+GH ++
Sbjct: 360 GDFHNMGHILI 370


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 64,620
Number of Sequences: 336
Number of extensions: 754
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 52
effective length of database: 105,113
effective search space used: 10406187
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -