BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30169X (455 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016663-3|AAC70878.1| 1170|Caenorhabditis elegans Hypothetical ... 27 8.6 >AF016663-3|AAC70878.1| 1170|Caenorhabditis elegans Hypothetical protein F21E9.1 protein. Length = 1170 Score = 26.6 bits (56), Expect = 8.6 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 316 APLIRI*KLYNKDKNFHCPPTFRRNSIRKLV*WS 417 AP I I + K FH PT +NSI +V WS Sbjct: 904 APTINISCFADDVKIFHTDPTIIQNSIDIIVSWS 937 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,167,366 Number of Sequences: 27780 Number of extensions: 68075 Number of successful extensions: 138 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 138 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 809909048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -