BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30168 (766 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28794| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_52330| Best HMM Match : MCM (HMM E-Value=0) 28 7.2 >SB_28794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/55 (23%), Positives = 23/55 (41%) Frame = -1 Query: 727 TIYKLTDCVFYLWIYCIFFFLYYD*SYTYPINCFNYEHKSWLASIKCFTDTQYYY 563 T+Y+ +Y + Y +++ YY Y Y + Y H + + YYY Sbjct: 95 TVYRQRHAYYYYYYYYYYYYYYYYYYYYYYYYYYYYHHYYYYYYYYYYYYYYYYY 149 >SB_52330| Best HMM Match : MCM (HMM E-Value=0) Length = 368 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +2 Query: 68 DHQGSTSRRNQR*EALVLGEVPTEVTSQEEWAQEQLL 178 D +G R R LGE+ +E+ ++EE A++++L Sbjct: 282 DEEGEEGLRRSRVVNWYLGEIQSEIETEEELAEKKML 318 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,419,377 Number of Sequences: 59808 Number of extensions: 365516 Number of successful extensions: 1072 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 772 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1064 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -