BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30167 (690 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC622.18 |rpl6||60S ribosomal protein L6|Schizosaccharomyces p... 46 7e-06 SPBP16F5.02 |mcs2||cyclin Mcs2|Schizosaccharomyces pombe|chr 2||... 28 1.1 SPBC800.13 |||histone H4 variant|Schizosaccharomyces pombe|chr 2... 28 1.5 SPAC13G7.02c |ssa1||heat shock protein Ssa1|Schizosaccharomyces ... 27 1.9 SPCC1739.13 |ssa2||heat shock protein Ssa2|Schizosaccharomyces p... 27 2.6 SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 26 5.9 SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces... 25 7.8 >SPCC622.18 |rpl6||60S ribosomal protein L6|Schizosaccharomyces pombe|chr 3|||Manual Length = 195 Score = 45.6 bits (103), Expect = 7e-06 Identities = 23/39 (58%), Positives = 27/39 (69%) Frame = -2 Query: 497 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCP 381 GTVCILLAGR GKRVV++ L L+VTGP+ N P Sbjct: 55 GTVCILLAGRFRGKRVVVLSQL-EDTLVVTGPYKVNGVP 92 Score = 32.3 bits (70), Expect = 0.068 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 387 VPVRRIPQRYVIGTST-RISLGNFKLPKHFNDDYFKKNKK 271 VP+RR+ RYVI TS +I + + K F YF K K+ Sbjct: 91 VPIRRVNHRYVIATSAPKIDVSGVSVEK-FTKAYFAKQKR 129 >SPBP16F5.02 |mcs2||cyclin Mcs2|Schizosaccharomyces pombe|chr 2|||Manual Length = 322 Score = 28.3 bits (60), Expect = 1.1 Identities = 23/93 (24%), Positives = 39/93 (41%), Gaps = 4/93 (4%) Frame = -1 Query: 405 TFCFQFVPVRRIP--QRYVIGTSTRI-SLGNFKLPKHFNDDYFKKNKKCVKRTAN-AKRV 238 T C Q++ ++IP Q +I S + + FK+ K DY +K C+ N + + Sbjct: 230 TICLQYIEAKKIPELQPLIISISANLKATKKFKIEKKKAQDYGRKLYFCMNPLRNKSSAL 289 Query: 237 MTSLPQKKRNTFHLSSAKPIRRQSTRL*SKPSE 139 ++ +T + AK S L P E Sbjct: 290 YLKRKAEEESTNNNKWAKKFSTSSNVLDKNPFE 322 >SPBC800.13 |||histone H4 variant|Schizosaccharomyces pombe|chr 2|||Manual Length = 479 Score = 27.9 bits (59), Expect = 1.5 Identities = 17/62 (27%), Positives = 31/62 (50%) Frame = -1 Query: 264 KRTANAKRVMTSLPQKKRNTFHLSSAKPIRRQSTRL*SKPSEPDPTRRCSADTSKRPSDS 85 KR A A+R SL +++ N F ++ + I R +R +K P P S++ P + Sbjct: 48 KRRALARR--NSLARRRSNVFSATTPRDILRMLSRALAKNPVPSPAESESSERRHTPQTN 105 Query: 84 AR 79 ++ Sbjct: 106 SQ 107 >SPAC13G7.02c |ssa1||heat shock protein Ssa1|Schizosaccharomyces pombe|chr 1|||Manual Length = 644 Score = 27.5 bits (58), Expect = 1.9 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = -1 Query: 318 KLPKHFNDDYFKKNKKCVKRTANAKRVMTSLPQKKRNTFHLSSAKPIRRQS 166 +L HF ++ +KNKK + A A R + + ++ + T S+ I S Sbjct: 234 RLVNHFAQEFKRKNKKDITGNARAVRRLRTACERAKRTLSSSAQASIEIDS 284 >SPCC1739.13 |ssa2||heat shock protein Ssa2|Schizosaccharomyces pombe|chr 3|||Manual Length = 647 Score = 27.1 bits (57), Expect = 2.6 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = -1 Query: 318 KLPKHFNDDYFKKNKKCVKRTANAKRVMTSLPQKKRNTFHLSSAKPIRRQS 166 +L HF ++ +KNKK + A A R + + ++ + T S+ I S Sbjct: 234 RLVNHFIQEFKRKNKKDITGNARAVRRLRTACERAKRTLSSSAQASIEIDS 284 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 25.8 bits (54), Expect = 5.9 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -2 Query: 143 RSPTRQEGAPRIPQSGLRTPLEPISPSVRF 54 RSP R R+ S P P+SPSV + Sbjct: 218 RSPARTPSPIRLYSSDALRPQSPLSPSVEY 247 >SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1639 Score = 25.4 bits (53), Expect = 7.8 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -1 Query: 309 KHFNDDYFKKNKKCVKRTANAKRVMTSLPQKKR 211 K F+D+ + KK V+ +A+A ++ PQKKR Sbjct: 342 KVFHDEKLNELKKQVEISASAAQLNGLYPQKKR 374 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,870,413 Number of Sequences: 5004 Number of extensions: 62821 Number of successful extensions: 192 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 187 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 192 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -