BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30167 (690 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 26 1.3 AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding pr... 25 2.3 AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding pr... 25 2.3 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 25 3.0 AY331407-1|AAQ97588.1| 101|Anopheles gambiae agCP14332 protein. 24 3.9 AY331406-1|AAQ97587.1| 96|Anopheles gambiae agCP14332 protein. 24 3.9 AY331405-1|AAQ97586.1| 96|Anopheles gambiae agCP14332 protein. 24 3.9 AY331408-1|AAQ97589.1| 100|Anopheles gambiae agCP14332 protein. 24 5.2 AY331404-1|AAQ97585.1| 100|Anopheles gambiae agCP14332 protein. 24 5.2 AY331403-1|AAQ97584.1| 103|Anopheles gambiae agCP14332 protein. 23 9.1 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 25.8 bits (54), Expect = 1.3 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +3 Query: 351 RSHSAEEYGVRARIESKRSSN*KQTAGQNSNKYNPLACMSTSEENANS 494 R + +G R+ S RSS A N +PL+ +S+S N++S Sbjct: 6 RRQRQKAFGKRSSSASLRSSAANFAAWLRGNSGSPLSSISSSSRNSSS 53 >AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding protein AgamOBP42 protein. Length = 288 Score = 25.0 bits (52), Expect = 2.3 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = -1 Query: 351 GTSTRISLGNFKLPKHFNDDYFKKNKKCVKRTA 253 GT L + +P + DY+ + +C++R A Sbjct: 83 GTLNEHVLAQYFMPDTSDSDYYNRTYRCIERKA 115 >AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding protein OBPjj83d protein. Length = 288 Score = 25.0 bits (52), Expect = 2.3 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = -1 Query: 351 GTSTRISLGNFKLPKHFNDDYFKKNKKCVKRTA 253 GT L + +P + DY+ + +C++R A Sbjct: 83 GTLNEHVLAQYFMPDTSDSDYYNRTYRCIERKA 115 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 24.6 bits (51), Expect = 3.0 Identities = 19/77 (24%), Positives = 32/77 (41%) Frame = -1 Query: 393 QFVPVRRIPQRYVIGTSTRISLGNFKLPKHFNDDYFKKNKKCVKRTANAKRVMTSLPQKK 214 Q + R+ + T+ + N KL +H N F ++ ++ NA PQ+K Sbjct: 81 QLLQKSRLKSSNLKSTTYTRNTENDKLTRHLNTVKFSFDEPVPQKPDNAAAEGAPKPQRK 140 Query: 213 RNTFHLSSAKPIRRQST 163 + KP RR +T Sbjct: 141 LSDRGEPPPKPDRRITT 157 >AY331407-1|AAQ97588.1| 101|Anopheles gambiae agCP14332 protein. Length = 101 Score = 24.2 bits (50), Expect = 3.9 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +1 Query: 421 RPLGRIPTSTTLLPACLPARRMQTVPIFRW-VGSCVHAC*MDGHQMKHG 564 R L T T PAR T+PI RW VG+ + +G +K+G Sbjct: 2 RSLHTTTTPCTRRNRTAPARNYDTIPIDRWRVGNRM----KEGRNVKNG 46 >AY331406-1|AAQ97587.1| 96|Anopheles gambiae agCP14332 protein. Length = 96 Score = 24.2 bits (50), Expect = 3.9 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +1 Query: 472 PARRMQTVPIFRWVGSCVHAC*MDGHQMKHGFSPEWG 582 PAR T+PI RW CV G++MK G + E G Sbjct: 19 PARNYDTIPIDRW---CV------GNRMKEGPNVENG 46 >AY331405-1|AAQ97586.1| 96|Anopheles gambiae agCP14332 protein. Length = 96 Score = 24.2 bits (50), Expect = 3.9 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +1 Query: 472 PARRMQTVPIFRWVGSCVHAC*MDGHQMKHGFSPEWG 582 PAR T+PI RW CV G++MK G + E G Sbjct: 19 PARNYDTIPIDRW---CV------GNRMKEGPNVENG 46 >AY331408-1|AAQ97589.1| 100|Anopheles gambiae agCP14332 protein. Length = 100 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 421 RPLGRIPTSTTLLPACLPARRMQTVPIFRW 510 R L T T PAR T+PI RW Sbjct: 2 RSLHTTTTPCTRRNRTAPARNYDTIPIDRW 31 >AY331404-1|AAQ97585.1| 100|Anopheles gambiae agCP14332 protein. Length = 100 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 421 RPLGRIPTSTTLLPACLPARRMQTVPIFRW 510 R L T T PAR T+PI RW Sbjct: 2 RSLHTTTTPCTRRNRTAPARNYDTIPIDRW 31 >AY331403-1|AAQ97584.1| 103|Anopheles gambiae agCP14332 protein. Length = 103 Score = 23.0 bits (47), Expect = 9.1 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 472 PARRMQTVPIFRW 510 PAR T+PI RW Sbjct: 20 PARNYDTIPIDRW 32 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 743,308 Number of Sequences: 2352 Number of extensions: 16642 Number of successful extensions: 45 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -