BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30167 (690 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 24 1.2 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 24 1.2 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 8.4 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 149 FDHSLVDCLLIGFALLRWNVFLFFCGKDVITLFA 250 FD +L+DC+ G L V ++ + TLFA Sbjct: 29 FDSTLLDCIQSGIENLDSGVGIYAPDAEAYTLFA 62 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 149 FDHSLVDCLLIGFALLRWNVFLFFCGKDVITLFA 250 FD +L+DC+ G L V ++ + TLFA Sbjct: 45 FDSTLLDCIQSGIENLDSGVGIYAPDAEAYTLFA 78 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 244 LCVCCTFDA 270 LC CC FDA Sbjct: 746 LCHCCDFDA 754 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,176 Number of Sequences: 438 Number of extensions: 4552 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -