BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30166 (602 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48345| Best HMM Match : Ribosomal_L22 (HMM E-Value=0) 122 2e-28 SB_52240| Best HMM Match : DUF1700 (HMM E-Value=4.1) 27 8.8 SB_33276| Best HMM Match : Glyco_transf_43 (HMM E-Value=0) 27 8.8 >SB_48345| Best HMM Match : Ribosomal_L22 (HMM E-Value=0) Length = 142 Score = 122 bits (294), Expect = 2e-28 Identities = 55/87 (63%), Positives = 70/87 (80%), Gaps = 2/87 (2%) Frame = +1 Query: 4 MGRYSREPDNPAKSCKARGSNLRVHFKNTYETAMAIRKMPLRRAVRYLKNVIEKKECIPF 183 M RY+ +P+NP KSCKARGSNLRVH+KNT+E AMAI+ M +R+A RYLK+V KK+ +PF Sbjct: 1 MTRYATDPENPTKSCKARGSNLRVHYKNTHEAAMAIKGMHVRKANRYLKDVCAKKQLVPF 60 Query: 184 RRFNGGVGRCAQAKQFGT--TQGRWPR 258 R++NGGVGR AQAK +QGRWP+ Sbjct: 61 RKYNGGVGRKAQAKNLKVPGSQGRWPK 87 Score = 90.6 bits (215), Expect = 8e-19 Identities = 43/57 (75%), Positives = 48/57 (84%) Frame = +3 Query: 243 GSLAKKSAEFLLQLLRNAESNADNKTLDVDRLVIDHIQVNRAPCLRRRTYRAHGRIN 413 G KKSAE LLQLL+NAESNA+ K LDVD LV++HIQVN AP +RRRTYRAHGRIN Sbjct: 83 GRWPKKSAEILLQLLKNAESNAEFKGLDVDSLVVEHIQVNEAPSMRRRTYRAHGRIN 139 >SB_52240| Best HMM Match : DUF1700 (HMM E-Value=4.1) Length = 254 Score = 27.5 bits (58), Expect = 8.8 Identities = 18/65 (27%), Positives = 29/65 (44%) Frame = +3 Query: 240 TGSLAKKSAEFLLQLLRNAESNADNKTLDVDRLVIDHIQVNRAPCLRRRTYRAHGRINPY 419 T +L + E L A + D T + +DH+ ++ + R YR +NP Sbjct: 22 TSALTECYHEALCMSYNEAPVSDDGLTFPCELNAVDHVVEDKL--VPRAGYRYCSFMNPC 79 Query: 420 MSSPC 434 +SSPC Sbjct: 80 VSSPC 84 >SB_33276| Best HMM Match : Glyco_transf_43 (HMM E-Value=0) Length = 1182 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +3 Query: 237 NTGSLAKKSAEFLLQLLRNAESNADNKTLDVDRLVIDHIQV 359 N ++++ A++ + +L + E N LD+D + DH V Sbjct: 828 NLEKISRRVADYKVNILNDPEDNKKLLVLDIDYTLFDHRSV 868 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,988,052 Number of Sequences: 59808 Number of extensions: 393680 Number of successful extensions: 1176 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1173 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -