BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30162 (758 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5KTL8 Cluster: Putative uncharacterized protein; n=1; ... 46 0.001 UniRef50_Q9BPP9 Cluster: Gag-like protein; n=2; Bombyx mori|Rep:... 40 0.088 UniRef50_Q6C679 Cluster: Similarity; n=1; Yarrowia lipolytica|Re... 36 1.4 UniRef50_Q6C8A7 Cluster: Similarities with tr|Q00658 Emericella ... 35 2.5 >UniRef50_Q5KTL8 Cluster: Putative uncharacterized protein; n=1; Bombyx mori|Rep: Putative uncharacterized protein - Bombyx mori (Silk moth) Length = 173 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +2 Query: 512 AIEWTMSTSARDGCLYRNAIN 574 AIEWTMSTSARDGCLYRN N Sbjct: 1 AIEWTMSTSARDGCLYRNDFN 21 >UniRef50_Q9BPP9 Cluster: Gag-like protein; n=2; Bombyx mori|Rep: Gag-like protein - Bombyx mori (Silk moth) Length = 553 Score = 39.5 bits (88), Expect = 0.088 Identities = 16/24 (66%), Positives = 21/24 (87%) Frame = -3 Query: 153 VFAEFLRLRHPQLASEFLAFKANH 82 +FAEFLRLR+P L++EFL FK +H Sbjct: 7 LFAEFLRLRYPTLSAEFLEFKTHH 30 >UniRef50_Q6C679 Cluster: Similarity; n=1; Yarrowia lipolytica|Rep: Similarity - Yarrowia lipolytica (Candida lipolytica) Length = 303 Score = 35.5 bits (78), Expect = 1.4 Identities = 18/65 (27%), Positives = 27/65 (41%) Frame = -1 Query: 638 GDKTKWRMDGEVMTIHTPVKYHL*HSDRGTRHVRTCSSSTRSPVFVRPAFVSPAIVRAAC 459 G T+ D + + +P + H H RG H CS + V VRP ++ C Sbjct: 70 GSDTETESDNDAEPLLSPSQPHNVHKYRGVLHCGVCSKVVKHGVQVRPLPCKDHVIHTEC 129 Query: 458 VCGTS 444 V G + Sbjct: 130 VTGNN 134 >UniRef50_Q6C8A7 Cluster: Similarities with tr|Q00658 Emericella nidulans FlbD; n=1; Yarrowia lipolytica|Rep: Similarities with tr|Q00658 Emericella nidulans FlbD - Yarrowia lipolytica (Candida lipolytica) Length = 478 Score = 34.7 bits (76), Expect = 2.5 Identities = 19/44 (43%), Positives = 24/44 (54%) Frame = -2 Query: 220 RRKASVFKTRGRPTWVLSDHGRCIRGIPPTSPPXARLGVFGLQG 89 RR+A++ + RPTW HG G PP PP A GV G+ G Sbjct: 105 RRRATLAAHQRRPTWDFGAHGGGPGGPPP--PPPATHGVPGMHG 146 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 673,343,370 Number of Sequences: 1657284 Number of extensions: 13205708 Number of successful extensions: 38841 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 36819 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38792 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 62969581935 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -