BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30162 (758 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-... 25 2.5 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 25 3.3 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 24 4.4 Z49832-1|CAA89993.1| 155|Anopheles gambiae serine proteinase pr... 24 5.9 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 23 7.7 >AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-A-gated chloride channelprotein. Length = 459 Score = 25.0 bits (52), Expect = 2.5 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 244 AVLLTQVAIXRDYY--RTKKKHNKTEITKRNKTNKYLQETTLSAD 372 A LL A+ Y+ R KKK K + +R K + +T SAD Sbjct: 298 AALLEYAAVNYTYWGARAKKKSKKNKEAERKVFGKTEKTSTCSAD 342 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 24.6 bits (51), Expect = 3.3 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +2 Query: 419 LPERALSRQMYHKHRPREQWPG*QKPGEQRR 511 LP+++ RQ HR +QWP Q+ G+Q++ Sbjct: 259 LPQQSAQRQP--AHRQHQQWPH-QQNGQQQQ 286 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 24.2 bits (50), Expect = 4.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 94 EGQKLRGELXVAKSEEFREYSVHDR*VPRWGGPG 195 E QK RGEL ++ + ++D P + GPG Sbjct: 136 ETQKRRGELVLSTFAQIDAILLNDGSTPTYVGPG 169 >Z49832-1|CAA89993.1| 155|Anopheles gambiae serine proteinase protein. Length = 155 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 272 GAITTGQRKSTTKQKLRKETKQINTCRKPL 361 GA+ G+R S+T QK++ + C K L Sbjct: 95 GALGFGERLSSTLQKIQLQALDETICAKRL 124 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 23.4 bits (48), Expect = 7.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 566 HSDRGTRHVRTCSSSTRSPVFV 501 H RG+RH R S ++ P F+ Sbjct: 834 HPPRGSRHTRQGSEASSPPPFL 855 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 708,629 Number of Sequences: 2352 Number of extensions: 14404 Number of successful extensions: 30 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -