BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30162 (758 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132898-18|CAC14411.2| 417|Caenorhabditis elegans Hypothetical... 32 0.38 U64835-8|AAY86281.1| 166|Caenorhabditis elegans Hypothetical pr... 29 4.7 >AL132898-18|CAC14411.2| 417|Caenorhabditis elegans Hypothetical protein Y59A8B.13 protein. Length = 417 Score = 32.3 bits (70), Expect = 0.38 Identities = 17/67 (25%), Positives = 27/67 (40%), Gaps = 1/67 (1%) Frame = +2 Query: 281 TTGQRKSTTKQKLRKETKQINTCRKPL-CRQMYHEHXXXXXXXXXXXLPERALSRQMYHK 457 TT + + T+ + K+T CRK L ++ Y EH + L R Sbjct: 44 TTQKFRQTSNGRTMKQTWTCGVCRKELSSKRSYTEHMNIHNKSRPFQSSQMTLHRHKLRN 103 Query: 458 HRPREQW 478 H P+ +W Sbjct: 104 HTPKAEW 110 >U64835-8|AAY86281.1| 166|Caenorhabditis elegans Hypothetical protein T09D3.8 protein. Length = 166 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 497 GEQRRAIEWTMSTSARDGCLYRNAINGTLQACESS*LH 610 G ++R EW + S DGC+ N T C S+ L+ Sbjct: 79 GMKKRPNEWLQTDSTSDGCVQWNVYCNTSPDCTSTILY 116 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,408,562 Number of Sequences: 27780 Number of extensions: 311008 Number of successful extensions: 769 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 718 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 768 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1809061256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -