BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30162 (758 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY496432-1|AAS75803.1| 95|Apis mellifera defensin/royalisin pr... 22 7.2 AJ308527-1|CAC33429.1| 57|Apis mellifera defensin protein. 22 7.2 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 22 7.2 >AY496432-1|AAS75803.1| 95|Apis mellifera defensin/royalisin precursor protein. Length = 95 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 480 GHCSRGLCLWYICR 439 GHC +G+C ICR Sbjct: 72 GHCEKGVC---ICR 82 >AJ308527-1|CAC33429.1| 57|Apis mellifera defensin protein. Length = 57 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 480 GHCSRGLCLWYICR 439 GHC +G+C ICR Sbjct: 47 GHCEKGVC---ICR 57 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.8 bits (44), Expect = 7.2 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +3 Query: 582 YRRVNRHDFTIHSPFSFITDKNQQGAHYFSP 674 Y+ + R D H P + +TD Y SP Sbjct: 416 YKNI-REDDARHIPHASVTDSENTVPRYLSP 445 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,323 Number of Sequences: 438 Number of extensions: 3646 Number of successful extensions: 16 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -