BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30161 (776 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 24 1.6 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.7 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 2.7 AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esteras... 22 4.8 AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 22 4.8 AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esteras... 22 4.8 AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esteras... 22 4.8 AJ850287-1|CAH64507.1| 509|Tribolium castaneum putative esteras... 22 4.8 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 683 IDNQPAP*CFSLKFSSSKRSPYI 615 + NQ + CFSLK + K P++ Sbjct: 517 LGNQNSEMCFSLKLKNKKLPPFL 539 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.0 bits (47), Expect = 2.7 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -1 Query: 203 PSQFTILLIRNNHTVLSLASSVELDNGI*NLIPSERIARIQCK 75 P ++ L +NN L L+ + E + NL +E++ + CK Sbjct: 295 PQDLSMKLSKNNDQCLDLSKTKETNLEKSNLNHNEQLRKYLCK 337 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.0 bits (47), Expect = 2.7 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -1 Query: 203 PSQFTILLIRNNHTVLSLASSVELDNGI*NLIPSERIARIQCK 75 P ++ L +NN L L+ + E + NL +E++ + CK Sbjct: 187 PQDLSMKLSKNNDQCLDLSKTKETNLEKSNLNHNEQLRKYLCK 229 >AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/23 (47%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -2 Query: 301 NEFSSFPCYFYK--IRFDVYFFK 239 N+ SS P YFY+ I D+ FK Sbjct: 401 NKTSSVPIYFYRMSIETDLNLFK 423 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/23 (47%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -2 Query: 301 NEFSSFPCYFYK--IRFDVYFFK 239 N+ SS P YFY+ I D+ FK Sbjct: 401 NKTSSVPIYFYRMSIETDLNLFK 423 >AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/23 (47%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -2 Query: 301 NEFSSFPCYFYK--IRFDVYFFK 239 N+ SS P YFY+ I D+ FK Sbjct: 401 NKTSSVPIYFYRMSIETDLNLFK 423 >AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esterase protein. Length = 510 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/23 (47%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -2 Query: 301 NEFSSFPCYFYK--IRFDVYFFK 239 N+ SS P YFY+ I D+ FK Sbjct: 401 NKTSSVPIYFYRMSIETDLNLFK 423 >AJ850287-1|CAH64507.1| 509|Tribolium castaneum putative esterase protein. Length = 509 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/23 (47%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -2 Query: 301 NEFSSFPCYFYK--IRFDVYFFK 239 N+ SS P YFY+ I D+ FK Sbjct: 400 NKTSSVPIYFYRMSIETDLNLFK 422 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,044 Number of Sequences: 336 Number of extensions: 3673 Number of successful extensions: 11 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20961338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -