BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30161 (776 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24677| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 3e-32 SB_24678| Best HMM Match : No HMM Matches (HMM E-Value=.) 122 2e-28 SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) 112 3e-25 SB_31360| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 7e-24 SB_51693| Best HMM Match : Pro_isomerase (HMM E-Value=3.5e-19) 64 1e-10 SB_25950| Best HMM Match : Pro_isomerase (HMM E-Value=2.5e-24) 62 6e-10 SB_24676| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) 57 1e-08 SB_3070| Best HMM Match : Pro_isomerase (HMM E-Value=2.3e-05) 53 2e-07 SB_32917| Best HMM Match : Pro_isomerase (HMM E-Value=5.1e-23) 49 5e-06 SB_39222| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_23239| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.79 SB_54075| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_21081| Best HMM Match : Pro_isomerase (HMM E-Value=0.11) 28 7.3 SB_42464| Best HMM Match : Pro_isomerase (HMM E-Value=3.9e-06) 28 9.7 SB_32386| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 >SB_24677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 135 bits (327), Expect = 3e-32 Identities = 61/89 (68%), Positives = 69/89 (77%) Frame = +1 Query: 499 TSSEPEGEGYKGSKFHRVIKNFMIQXXXXXXXXXXXXRSIYGERFEDENFKLKHYGAGWL 678 T +G GYK S FHRVI++FMIQ +SIYG++F DENFKL+HYGAGWL Sbjct: 80 TIESQKGFGYKNSIFHRVIQDFMIQGGDFTKGDGTGGKSIYGQKFADENFKLQHYGAGWL 139 Query: 679 SMANAGKDTNGSQFFITTVKTPWLDGRHL 765 SMANAGKDTNGSQFFITTVKTPWLDGRH+ Sbjct: 140 SMANAGKDTNGSQFFITTVKTPWLDGRHV 168 Score = 34.7 bits (76), Expect = 0.084 Identities = 20/41 (48%), Positives = 25/41 (60%) Frame = +2 Query: 338 LLFIASAKSDEIPKGPKVTHKVSFDMKIGDDNIGTIVIGLF 460 L F+AS+ + K P VT KV FD+ IG + G I IGLF Sbjct: 12 LFFLASSAA----KDPIVTKKVFFDITIGGEKAGRIEIGLF 48 >SB_24678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 122 bits (295), Expect = 2e-28 Identities = 55/90 (61%), Positives = 65/90 (72%) Frame = +1 Query: 493 LSTSSEPEGEGYKGSKFHRVIKNFMIQXXXXXXXXXXXXRSIYGERFEDENFKLKHYGAG 672 ++ + + +G GYK S FHRVIKNFMIQ SIYG+ F+DENF LKHYG G Sbjct: 59 VALADKEQGFGYKDSIFHRVIKNFMIQGGDFTNKDGTGGYSIYGKYFDDENFNLKHYGPG 118 Query: 673 WLSMANAGKDTNGSQFFITTVKTPWLDGRH 762 WL MANAGK+TNGSQF+ITT+KT WLDG H Sbjct: 119 WLCMANAGKNTNGSQFYITTIKTSWLDGSH 148 Score = 50.8 bits (116), Expect = 1e-06 Identities = 27/65 (41%), Positives = 35/65 (53%) Frame = +2 Query: 338 LLFIASAKSDEIPKGPKVTHKVSFDMKIGDDNIGTIVIGLFGKTVPKTTENFFQLAQNLR 517 L+F+A +D VT KV D+ IG G +++GLFG T PKT NF LA + Sbjct: 8 LVFVAFVNADTETTA-SVTKKVWMDVSIGGQPAGRVILGLFGDTAPKTVANFVALADKEQ 66 Query: 518 GRGTK 532 G G K Sbjct: 67 GFGYK 71 >SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) Length = 298 Score = 112 bits (269), Expect = 3e-25 Identities = 51/84 (60%), Positives = 60/84 (71%) Frame = +1 Query: 514 EGEGYKGSKFHRVIKNFMIQXXXXXXXXXXXXRSIYGERFEDENFKLKHYGAGWLSMANA 693 +G GYKGS FHR+I FM Q +SIYG +FEDENF LKH GAG LSMAN+ Sbjct: 177 KGFGYKGSSFHRIIPQFMCQGGDFTKHNGTGGKSIYGAKFEDENFVLKHTGAGVLSMANS 236 Query: 694 GKDTNGSQFFITTVKTPWLDGRHL 765 G +TNGSQFF+TT KT WLDG+H+ Sbjct: 237 GPNTNGSQFFLTTEKTDWLDGKHV 260 Score = 41.9 bits (94), Expect = 6e-04 Identities = 22/52 (42%), Positives = 31/52 (59%) Frame = +2 Query: 386 KVTHKVSFDMKIGDDNIGTIVIGLFGKTVPKTTENFFQLAQNLRGRGTKGAS 541 +V +V FD+ IG+ + G IV+ L VP T ENF L + +G G KG+S Sbjct: 134 RVNPRVFFDITIGERSAGRIVMELRSDVVPMTAENFRCLCTHEKGFGYKGSS 185 >SB_31360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 107 bits (258), Expect = 7e-24 Identities = 50/84 (59%), Positives = 56/84 (66%) Frame = +1 Query: 514 EGEGYKGSKFHRVIKNFMIQXXXXXXXXXXXXRSIYGERFEDENFKLKHYGAGWLSMANA 693 +G GYKGS FHRVI FM Q +SIYG +F DENF LKH G G LSMANA Sbjct: 43 KGFGYKGSSFHRVIPGFMCQGGDFTRGDGTGGKSIYGAKFADENFNLKHTGPGILSMANA 102 Query: 694 GKDTNGSQFFITTVKTPWLDGRHL 765 G TNGSQFF+ T KT WLDG+H+ Sbjct: 103 GPGTNGSQFFLCTAKTSWLDGKHV 126 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/53 (45%), Positives = 30/53 (56%) Frame = +2 Query: 383 PKVTHKVSFDMKIGDDNIGTIVIGLFGKTVPKTTENFFQLAQNLRGRGTKGAS 541 PK T+ FD++IG G IV+ L VPKT ENF L +G G KG+S Sbjct: 2 PKTTY---FDIEIGGAPAGRIVMELRDDVVPKTAENFRALCTGEKGFGYKGSS 51 >SB_51693| Best HMM Match : Pro_isomerase (HMM E-Value=3.5e-19) Length = 99 Score = 64.1 bits (149), Expect = 1e-10 Identities = 31/51 (60%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = +1 Query: 613 SIYGERFEDENFK-LKHYGAGWLSMANAGKDTNGSQFFITTVKTPWLDGRH 762 SI+G FEDE + L+H +SMANAG +TNGSQFFIT V TPWLD +H Sbjct: 8 SIWGGEFEDEFHRNLRHDRPYTVSMANAGPNTNGSQFFITVVPTPWLDNKH 58 >SB_25950| Best HMM Match : Pro_isomerase (HMM E-Value=2.5e-24) Length = 145 Score = 61.7 bits (143), Expect = 6e-10 Identities = 25/51 (49%), Positives = 35/51 (68%) Frame = +1 Query: 613 SIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTVKTPWLDGRHL 765 S+YG FEDE+F + H G + MAN G+ TNGSQF+IT PW+D +++ Sbjct: 51 SVYGPLFEDEDFSVAHNRRGVVGMANKGRHTNGSQFYITLQPAPWMDTKYV 101 >SB_24676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 60.1 bits (139), Expect = 2e-09 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 682 MANAGKDTNGSQFFITTVKTPWLDGRHL 765 MANAGKDTNGSQFFITTVKT WLDG+H+ Sbjct: 1 MANAGKDTNGSQFFITTVKTSWLDGKHV 28 >SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) Length = 741 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +1 Query: 655 KHYGAGWLSMANAGKDTNGSQFFITTVKTPWLDGRHL 765 +H G LSMAN+G +TNGSQFFITTV TP LDGRH+ Sbjct: 188 EHDKPGLLSMANSGPNTNGSQFFITTVPTPHLDGRHV 224 >SB_3070| Best HMM Match : Pro_isomerase (HMM E-Value=2.3e-05) Length = 49 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +1 Query: 676 LSMANAGKDTNGSQFFITTVKTPWLDGRHL 765 LSMANAG TNGSQFF+ T KT WLDG+H+ Sbjct: 3 LSMANAGPGTNGSQFFLCTAKTSWLDGKHV 32 >SB_32917| Best HMM Match : Pro_isomerase (HMM E-Value=5.1e-23) Length = 378 Score = 48.8 bits (111), Expect = 5e-06 Identities = 25/41 (60%), Positives = 27/41 (65%) Frame = +1 Query: 613 SIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTV 735 SIYG F DE F+ KH LSMAN G +TNGSQFFI V Sbjct: 31 SIYGGTFGDECFEFKHERPMLLSMANRGPNTNGSQFFIIHV 71 >SB_39222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1651 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Frame = +1 Query: 625 ERFEDENFKL----KHYGAGWLSMANAGKDTNGSQFFITTVKTPWLDGRH 762 E +DE L H G +SMAN G ++NGSQFFI K P LD ++ Sbjct: 286 EELDDEALDLMGRCNHNARGTVSMANNGPNSNGSQFFICYGKQPHLDMKY 335 >SB_23239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 31.5 bits (68), Expect = 0.79 Identities = 24/77 (31%), Positives = 32/77 (41%), Gaps = 1/77 (1%) Frame = +1 Query: 526 YKGSKFHRVIKNFMIQXXXXXXXXXXXXRSIYGERFEDENFKLKHYGAGWLSMANAG-KD 702 Y G++FHRVI FM+Q + D H G L+MA +D Sbjct: 60 YAGTQFHRVIPGFMVQGGGFDADMQQKDTQAPIKNEADNGL---HNVRGTLAMARTQVRD 116 Query: 703 TNGSQFFITTVKTPWLD 753 + SQFFI +LD Sbjct: 117 SATSQFFINHKDNAFLD 133 >SB_54075| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 729 Score = 28.7 bits (61), Expect = 5.5 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = -3 Query: 570 DHEIFNYSVELAPFVPLPLRF*AS*KKFSVVLGTVFPNNPITIVP 436 D N++ +L +PL +R KF L T+F NN IT +P Sbjct: 339 DRSFSNFAAKLWNSLPLHIRNTDCLSKFKSSLKTIFENNLITSLP 383 >SB_21081| Best HMM Match : Pro_isomerase (HMM E-Value=0.11) Length = 48 Score = 28.3 bits (60), Expect = 7.3 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 437 GTIVIGLFGKTVPKTTENFFQLAQNLRGRG 526 G ++ LF VPKT ENF L +G G Sbjct: 2 GRVLFELFADKVPKTAENFRALCTGEKGIG 31 >SB_42464| Best HMM Match : Pro_isomerase (HMM E-Value=3.9e-06) Length = 454 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 431 NIGTIVIGLFGKTVPKTTENFFQL 502 ++G I I L+GK PK NF QL Sbjct: 11 SVGDIDIELWGKETPKACRNFIQL 34 >SB_32386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.9 bits (59), Expect = 9.7 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -3 Query: 393 VTLGPLGISSDLALAMNNKIPKAIVRVPMIKTSL 292 VTL PL +S+ ++N + A+VRV I SL Sbjct: 38 VTLSPLQVSAKTGASLNGRAEVAMVRVSPILASL 71 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,055,953 Number of Sequences: 59808 Number of extensions: 421667 Number of successful extensions: 677 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 675 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2119930593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -