BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30160 (660 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 25 0.73 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 24 0.96 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 24 0.96 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 3.9 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 5.1 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 24.6 bits (51), Expect = 0.73 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -2 Query: 269 PASKALSSAVHIRRTPSARTVESRQRSLSSYP 174 PA + + I RTP + R+R L YP Sbjct: 37 PAYPIIGNLFDIMRTPEQMFLADRERGLKYYP 68 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 24.2 bits (50), Expect = 0.96 Identities = 15/53 (28%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = -2 Query: 305 QFFTRYLLQQIRPAS--KALSSAVHIRRTPSARTVESRQRSLSSYPNRRYGSW 153 QF + +R A LSS H PS R + R +Y + SW Sbjct: 267 QFISNTWQNSLRAADIQPTLSSIRHPESNPSERVMRELGRIFRAYCRENHASW 319 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 24.2 bits (50), Expect = 0.96 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -2 Query: 269 PASKALSSAVHIRRTPSARTVESRQRSLSSYP 174 PA + + I RTP + R+R L YP Sbjct: 37 PAYPIIGNLFDIMRTPEQLFLAERERGLKYYP 68 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.2 bits (45), Expect = 3.9 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -3 Query: 229 GHQVHAQWKVVN 194 GH +HAQ VVN Sbjct: 327 GHHIHAQHHVVN 338 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -1 Query: 237 YSSDTKCTHSGKSSTFALFLPKSKIRILGS 148 Y+ D CTH ++ P+S +GS Sbjct: 365 YNQDVSCTHYQNPEYISVVNPESPYPQIGS 394 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,601 Number of Sequences: 336 Number of extensions: 3734 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -