BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30159 (627 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) 118 5e-27 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 29 4.1 SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) 28 5.4 SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) 28 5.4 SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) 27 9.4 SB_19612| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) Length = 157 Score = 118 bits (283), Expect = 5e-27 Identities = 56/83 (67%), Positives = 70/83 (84%) Frame = +2 Query: 5 STKIIKASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVP 184 S KI+K G A+ FE ISQA++ELE NSD+KAQLRELYI+ AKEI++ KK+III+VP Sbjct: 8 SAKIVKPQGETANEFEQGISQAILELEMNSDMKAQLRELYISSAKEIDVGGKKAIIIFVP 67 Query: 185 MPKLKAFQKIQIRLVRELEKKFS 253 +P+++AFQKIQ RLVRELEKKFS Sbjct: 68 VPQIRAFQKIQTRLVRELEKKFS 90 Score = 41.5 bits (93), Expect(2) = 2e-08 Identities = 20/35 (57%), Positives = 25/35 (71%) Frame = +1 Query: 241 KEVQCKHVVFVGDRKILPKPSHKTRVANKQKRPRS 345 K+ KHVV V R+ILP+P+ K+R KQKRPRS Sbjct: 87 KKFSGKHVVIVAQRRILPRPTRKSR-NQKQKRPRS 120 Score = 34.7 bits (76), Expect(2) = 2e-08 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = +1 Query: 457 HLDKNQQTTIEHKVDTF 507 HLDK QQTTI+HK++TF Sbjct: 121 HLDKTQQTTIDHKLETF 137 Score = 31.9 bits (69), Expect = 0.44 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = +3 Query: 510 SVYKKLTGREVTFEFP 557 +VYKKLTG++V FEFP Sbjct: 139 TVYKKLTGKDVVFEFP 154 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 28.7 bits (61), Expect = 4.1 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 4/82 (4%) Frame = +2 Query: 14 IIKASGAEADSFETSISQALVELETNSDLKAQLRE----LYITKAKEIELHNKKSIIIYV 181 ++++SG +S E+ + E N+ LK +L E L +T+ +E E+ N K + +YV Sbjct: 1681 VLESSGGTMNSEESFFLE-----EDNAILKRKLDEKETALKVTQDREREM-NDKLMALYV 1734 Query: 182 PMPKLKAFQKIQIRLVRELEKK 247 M KL++ Q ELEK+ Sbjct: 1735 NMSKLESTQGTLEEKNAELEKE 1756 >SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) Length = 1552 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 41 DSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPM-PKLKAFQ 208 + ++T ++ L + L+ +RELY +E E KKS++ ++ + PK+K + Sbjct: 171 EQWDTILTMIPARLVQSPQLQPYIRELYAEVKQEYEASIKKSMVQHILVKPKVKGVE 227 >SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 1831 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 93 PTSKPNFGSFTLQKLKKLNYTIRS 164 P S N+G FT+++LK +YT +S Sbjct: 1415 PLSNDNYGDFTMRRLKVSSYTEQS 1438 >SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) Length = 417 Score = 27.5 bits (58), Expect = 9.4 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 9/42 (21%) Frame = +3 Query: 72 WSNSKPTPTSKPN--------FG-SFTLQKLKKLNYTIRSRS 170 WS+ KPTP KPN FG T Q L+K N+ + RS Sbjct: 125 WSDPKPTPGCKPNTFRGGGCYFGPDVTSQVLRKHNFELLVRS 166 >SB_19612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 932 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -2 Query: 482 VVCWFLSKCTLMSCEPSNLTLMRLPTISAGKTKSSR 375 V+CW L + + + EP N L +L ++ GK K S+ Sbjct: 339 VICWVLGEYSYIVSEP-NTVLEQLHSLLDGKLKDSK 373 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,610,707 Number of Sequences: 59808 Number of extensions: 350291 Number of successful extensions: 906 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 838 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 901 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -