BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30157 (693 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 24 1.4 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 24 1.4 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 23 1.8 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 7.2 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 23.8 bits (49), Expect = 1.4 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = +3 Query: 555 NGRVTESWHLRPRASAKTIKTIPRCAFASFFCAWRSCVRFLLKHVW 692 N R S L PRA KTIK I + F W + F L V+ Sbjct: 232 NSRRASSRGLIPRAKVKTIK-ITFVIVSVFILCWSPYIIFDLLQVF 276 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 23.8 bits (49), Expect = 1.4 Identities = 19/49 (38%), Positives = 28/49 (57%) Frame = +3 Query: 318 SILLTSNVYLWLVLAADVRVHACVCSRDSKF*KVLEH*GLGVYFFVTLQ 464 S L+ ++WLVL++ VR +A SR F K++ + G G Y VT Q Sbjct: 488 SFLVNDFGFIWLVLSSTVRAYA---SR--AFKKIVTYKG-GKYRKVTFQ 530 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 665 TRTPRTKKRGKGAARDRFYS 606 +RTPR K G+G +RF S Sbjct: 212 SRTPRPKHDGRGRIVERFTS 231 Score = 22.2 bits (45), Expect = 4.1 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 65 MGSKAPSCPPQPQ 27 +GS A +CPP P+ Sbjct: 89 LGSYAANCPPSPK 101 Score = 21.4 bits (43), Expect = 7.2 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -3 Query: 103 GSKAPSCPPQPQ 68 GS A +CPP P+ Sbjct: 90 GSYAANCPPSPK 101 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -2 Query: 83 PTSTSKMGSKAPSCPPQPQKW 21 P++ S GSK P+P +W Sbjct: 416 PSTPSADGSKPVQTTPKPGQW 436 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,149 Number of Sequences: 336 Number of extensions: 3697 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18218375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -