BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30157 (693 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57511| Best HMM Match : EGF_CA (HMM E-Value=0) 30 1.5 SB_20121| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_14604| Best HMM Match : PT (HMM E-Value=5.1) 29 4.7 SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) 28 6.2 SB_37182| Best HMM Match : DUF225 (HMM E-Value=1) 28 8.3 SB_37180| Best HMM Match : zf-AN1 (HMM E-Value=3.7) 28 8.3 >SB_57511| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 879 Score = 30.3 bits (65), Expect = 1.5 Identities = 24/77 (31%), Positives = 34/77 (44%) Frame = +2 Query: 83 ARRCFTSRLFFEQYG*MRIRPDFASLLFSCVVSVMFSICIGEYCRQQRATVLDVSYTANS 262 +RRC R+F R+ D ++FSC V + + C RA DV N+ Sbjct: 196 SRRCVPHRVFISLCSPSRVHVDVFPIVFSC-RCVPHRVLM-SMCSPTRA---DVDVLPNT 250 Query: 263 VKESCRCLKLRSLGQLC 313 SCRC+ R L +C Sbjct: 251 C--SCRCVPHRVLMSMC 265 >SB_20121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2306 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -2 Query: 152 QNPAESASNHTAQKINGK*STVVPTSTSKMGSKAPSCPPQPQKW 21 Q AE S KI + T PT+ + G+K PP+ +KW Sbjct: 789 QREAEDLSARCT-KIQNRDRTQTPTTHVQQGTKTAKMPPRIEKW 831 >SB_14604| Best HMM Match : PT (HMM E-Value=5.1) Length = 344 Score = 28.7 bits (61), Expect = 4.7 Identities = 18/61 (29%), Positives = 30/61 (49%) Frame = -2 Query: 188 TLPTQHS*TVGTQNPAESASNHTAQKINGK*STVVPTSTSKMGSKAPSCPPQPQKWEVKH 9 TL T+ + + NP + A+ K G +T + T+ + G +A + +PQ WE K Sbjct: 270 TLGTKPKPSGPSHNPRDQATTLGTNKNPGDQATTLETNKNP-GDQATTLGTKPQPWEKKK 328 Query: 8 R 6 R Sbjct: 329 R 329 Score = 28.7 bits (61), Expect = 4.7 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Frame = -3 Query: 187 HYRHNTAKQ*GRKIRPNPHLTIL-LKK*TGSKAPSCPPQPQKWEVKHRRAHLNLKN 23 H + A G P T L K G +A + +PQ WE K R +L L+N Sbjct: 282 HNPRDQATTLGTNKNPGDQATTLETNKNPGDQATTLGTKPQPWEKKKRITYLGLEN 337 >SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2672 Score = 28.3 bits (60), Expect = 6.2 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +3 Query: 90 GALLPVYFLSSMVRCGFGRILRPYCLAVLC 179 GAL P Y LSS VR GR +R +CL C Sbjct: 2411 GALDPKYVLSSRVRT--GRSIRGFCLPPHC 2438 >SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 885 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 290 LRSLGQLCDIHSSHFKCLSLARPRCRCK 373 + S G+L H+S + L RPRCRC+ Sbjct: 342 ISSTGRLYCPHTSRAEVLCRRRPRCRCR 369 >SB_37182| Best HMM Match : DUF225 (HMM E-Value=1) Length = 1282 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +2 Query: 272 SCRCLKLRSLGQLCDIHSSHFKCLSLARPRCRCKS 376 SCRC+ R L +C S+H +A CRC S Sbjct: 275 SCRCVSHRVLMSMCSPLSAHVDVFPIA-CSCRCVS 308 >SB_37180| Best HMM Match : zf-AN1 (HMM E-Value=3.7) Length = 519 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = +2 Query: 197 CIGEYCRQQRATVLDVSYTANSVKESCRCLKLRSLGQLCDIHSSHFKCLSLARPRCRC 370 C+ + + L V + SCRC+ R L +C + +H +A CRC Sbjct: 50 CVSDRVLMPMCSPLCVHVDVFPIACSCRCVSHRGLMSMCFLSRAHVDVFLIA-CSCRC 106 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,733,623 Number of Sequences: 59808 Number of extensions: 480338 Number of successful extensions: 1173 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1035 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1168 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -