BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30157 (693 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48890.1 68418.m06048 hypothetical protein 31 0.96 At2g38950.1 68415.m04786 transcription factor jumonji (jmj) fami... 31 0.96 At5g54020.1 68418.m06719 expressed protein 29 3.9 At1g13130.1 68414.m01522 glycosyl hydrolase family 5 protein / c... 29 3.9 At3g18680.2 68416.m02373 aspartate/glutamate/uridylate kinase fa... 28 5.1 At3g18680.1 68416.m02372 aspartate/glutamate/uridylate kinase fa... 28 5.1 At5g08610.1 68418.m01024 DEAD box RNA helicase (RH26) strong sim... 28 6.8 At5g04240.1 68418.m00414 zinc finger (C2H2 type) family protein ... 28 6.8 At3g17920.1 68416.m02282 leucine-rich repeat family protein cont... 28 6.8 At5g15580.1 68418.m01824 expressed protein unknown protein F14P3... 27 8.9 At4g27470.1 68417.m03947 zinc finger (C3HC4-type RING finger) fa... 27 8.9 >At5g48890.1 68418.m06048 hypothetical protein Length = 173 Score = 30.7 bits (66), Expect = 0.96 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +2 Query: 197 CIGEYCRQQRATVLDVSY-TANSVKESCRCLKL 292 C G YC QQR +LD Y NS K +CL L Sbjct: 137 CKGGYCCQQRVDILDHHYNVVNSDKGKDQCLDL 169 >At2g38950.1 68415.m04786 transcription factor jumonji (jmj) family protein / zinc finger (C5HC2 type) family protein contains Pfam domains, PF02375: jmjN domain, PF02373: jmjC domain and PF02928: C5HC2 zinc finger Length = 708 Score = 30.7 bits (66), Expect = 0.96 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +2 Query: 236 LDVSYTANSVKESCRCLKLRSLGQL-CDIHSSHFKCLSLARPRCRCKSAR 382 +D SY A + +E C CL L + C ++ + CL+ R C C R Sbjct: 532 MDKSYDAVNKRECCVCLGDLYLSAVNCSCSANRYSCLNHMRKLCACPCDR 581 >At5g54020.1 68418.m06719 expressed protein Length = 556 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +2 Query: 200 IGEYCRQQRATVLDVSYTANSVKESCRCLKLRSLGQLC 313 I +C ++ LD +Y ++V CRC L G C Sbjct: 267 IVHFCHEEHVLRLDENYVTDNVNMRCRCCVLAIDGDPC 304 >At1g13130.1 68414.m01522 glycosyl hydrolase family 5 protein / cellulase family protein Length = 552 Score = 28.7 bits (61), Expect = 3.9 Identities = 19/50 (38%), Positives = 25/50 (50%) Frame = +2 Query: 236 LDVSYTANSVKESCRCLKLRSLGQLCDIHSSHFKCLSLARPRCRCKSARL 385 LDV N V +C+CL S + C+ S FK + RP KS+RL Sbjct: 501 LDVDTANNVVANACKCL---SKDKSCEPMSQWFKIIKATRP---LKSSRL 544 >At3g18680.2 68416.m02373 aspartate/glutamate/uridylate kinase family protein similar to UMP-kinase GB:CAB38122 gi:4468612 from [Lactococcus lactis] ; contains Pfam profile PF00696: Amino acid kinase family Length = 366 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = -1 Query: 426 ALKLSKI*NPYYRRKRALLHLQRGR 352 A ++S++ PY RR RA+ HL++GR Sbjct: 195 AFRMSEVAEPYIRR-RAIRHLEKGR 218 >At3g18680.1 68416.m02372 aspartate/glutamate/uridylate kinase family protein similar to UMP-kinase GB:CAB38122 gi:4468612 from [Lactococcus lactis] ; contains Pfam profile PF00696: Amino acid kinase family Length = 339 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = -1 Query: 426 ALKLSKI*NPYYRRKRALLHLQRGR 352 A ++S++ PY RR RA+ HL++GR Sbjct: 195 AFRMSEVAEPYIRR-RAIRHLEKGR 218 >At5g08610.1 68418.m01024 DEAD box RNA helicase (RH26) strong similarity to RNA helicase RH26 [Arabidopsis thaliana] GI:3776025; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH26 GI:3776024 Length = 850 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -2 Query: 692 PNMFQQEPNTRTPRTKKRGKGAARDRFYSFSAGSRSEMPGFGN 564 P + ++ + T R +RG+ DRF G EM FG+ Sbjct: 117 PEVVRRNVDRDTSRGPRRGREGQSDRFGGAKRGKEGEMDRFGS 159 >At5g04240.1 68418.m00414 zinc finger (C2H2 type) family protein / transcription factor jumonji (jmj) family protein contains Pfam domians PF02375: jmjN domain, PF02373: jmjC domain and PF00096: Zinc finger, C2H2 type Length = 1327 Score = 27.9 bits (59), Expect = 6.8 Identities = 18/66 (27%), Positives = 31/66 (46%) Frame = -1 Query: 333 K*EEWISHNCPKLRNLRHLHDSFTELAV*ETSKTVARCCRQYSPIQILNITDTTQLNSRD 154 K E+ I ++ K N + + ELA SK + C+ +S L+ +++NS Sbjct: 807 KEEKIIQYSRKKKLNPKPSAEQVQELATLAKSKDFDKTCKNFSSRSHLDSAIRSEMNSEI 866 Query: 153 AKSGRI 136 SGR+ Sbjct: 867 GDSGRV 872 >At3g17920.1 68416.m02282 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 962 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -3 Query: 106 TGSKAPSCPPQPQKWEVKHRRAHL 35 TGS +PS PP QK +V HRR +L Sbjct: 512 TGSFSPSSPPHYQK-DVLHRRQNL 534 >At5g15580.1 68418.m01824 expressed protein unknown protein F14P3.18 - Arabidopsis thaliana, EMBL:AC009755 Length = 927 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = -3 Query: 202 DTDTEHYRHNTAKQ*GRKIRPNPHLTILLKK*TGSKA-PSCPPQPQKWEVKHRR 44 D+ Y ++ G K++ P L++ + + A SC P+PQ+ HRR Sbjct: 204 DSPRFSYDERETRKTGAKLKETPRLSLDSRSNSFRSARSSCSPEPQELVTGHRR 257 >At4g27470.1 68417.m03947 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 243 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 575 LASPTESQR*NYKNDPSLRLCLFFLCVAFVCSVL 676 +A P +SQR + R+ +FFLC +C +L Sbjct: 209 IAQPYQSQRMMQREKSLNRVSIFFLCCIILCLLL 242 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,450,226 Number of Sequences: 28952 Number of extensions: 319003 Number of successful extensions: 760 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 731 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 759 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1477286152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -