BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30156 (685 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory pro... 22 5.4 AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory recept... 21 7.1 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 21 7.1 AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochr... 21 9.4 >DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory protein 19 protein. Length = 119 Score = 21.8 bits (44), Expect = 5.4 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -3 Query: 560 HMLTYNXXXXXXXXXRASIDEDIIYFKRYKKELQN 456 H L++N A D D IYF++YK + + Sbjct: 86 HFLSHNKQQMWKELT-AKYDPDGIYFEKYKDKFDS 119 >AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory receptor candidate 52 protein. Length = 360 Score = 21.4 bits (43), Expect = 7.1 Identities = 9/14 (64%), Positives = 12/14 (85%), Gaps = 1/14 (7%) Frame = -2 Query: 369 LC-EMVNEGETIIG 331 LC E+ NEG+TI+G Sbjct: 278 LCDEICNEGQTILG 291 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.4 bits (43), Expect = 7.1 Identities = 9/14 (64%), Positives = 12/14 (85%), Gaps = 1/14 (7%) Frame = -2 Query: 369 LC-EMVNEGETIIG 331 LC E+ NEG+TI+G Sbjct: 278 LCDEICNEGQTILG 291 >AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 125 Score = 21.0 bits (42), Expect = 9.4 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 509 SIDEDIIYFKRYKKELQNSGHLH 441 S+ EDI+ + +K + + HLH Sbjct: 67 SLGEDIVTYSGHKLKAGSMVHLH 89 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,271 Number of Sequences: 336 Number of extensions: 2291 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -