BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30155 (392 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 23 1.1 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 1.1 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 22 2.5 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 23.0 bits (47), Expect = 1.1 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +3 Query: 12 PPSLPSNRCGSRNRSTTSLAPPLYTGSASKRTARR 116 PP P + T S PPLY +KR R Sbjct: 733 PPPPPRVESFAETVRTVSKIPPLYKDLVAKRCEER 767 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.0 bits (47), Expect = 1.1 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = +3 Query: 21 LPSNRCGSRNRSTTSLAPPLYTGSA--SKRTA 110 LP++RC SR S + + P +G + S+R A Sbjct: 79 LPNSRCNSRESSDSLVQPRCPSGESMLSERAA 110 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.8 bits (44), Expect = 2.5 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 Query: 18 SLPSNRCGSRNRSTTSLAPPLYTGSASKRTARRC 119 SL S + N+S+TS PP + S SK C Sbjct: 56 SLLSPSGNTPNKSSTSPYPPNHPLSGSKHLCSIC 89 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 73,338 Number of Sequences: 336 Number of extensions: 1248 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8330471 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -