BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30155 (392 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr 2||... 68 6e-13 SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit Arp42|Sc... 41 6e-05 SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomy... 41 6e-05 SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces pomb... 30 0.11 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 25 4.2 SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces p... 25 5.5 SPAC13G7.13c |msa1|SPAC6C3.01c|RNA-binding protein Msa1|Schizosa... 24 7.3 >SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr 2|||Manual Length = 375 Score = 67.7 bits (158), Expect = 6e-13 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGP IV+RKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPGIVYRKCF 375 >SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit Arp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 430 Score = 41.1 bits (92), Expect = 6e-05 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESG 70 SILASL FQ +W+SKQEYDE G Sbjct: 396 SILASLDNFQHLWVSKQEYDEVG 418 >SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomyces pombe|chr 2|||Manual Length = 433 Score = 41.1 bits (92), Expect = 6e-05 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 3/34 (8%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGP---SIVHRKC 94 SIL+SL TF Q+WIS+QEY+E G +++ ++C Sbjct: 399 SILSSLGTFHQLWISRQEYEEHGSDRLALIEKRC 432 >SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 379 Score = 30.3 bits (65), Expect = 0.11 Identities = 14/32 (43%), Positives = 25/32 (78%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTF+++ I+ +EY ++ +++ R+ F Sbjct: 349 SILASLSTFRRLLITSEEY-KNDQNVIFRRRF 379 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 25.0 bits (52), Expect = 4.2 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 12 PPSLPSNRCGSRNRSTTSLAPP 77 PPS+PS+R R S ++ APP Sbjct: 233 PPSIPSSRPPERVPSLSAPAPP 254 >SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 2280 Score = 24.6 bits (51), Expect = 5.5 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 17 LSTFQQMWISKQEYDESGPSIV 82 L + + W KQ++DES S+V Sbjct: 2195 LQKWYEEWCGKQDWDESDKSVV 2216 >SPAC13G7.13c |msa1|SPAC6C3.01c|RNA-binding protein Msa1|Schizosaccharomyces pombe|chr 1|||Manual Length = 533 Score = 24.2 bits (50), Expect = 7.3 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 21 LPSNRCGSRNRSTTSLAPPLYTGSAS 98 +P + STT + PPL T S+S Sbjct: 31 IPPGSLSENDNSTTFIKPPLETASSS 56 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,254,139 Number of Sequences: 5004 Number of extensions: 18712 Number of successful extensions: 48 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 130061696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -