BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30155 (392 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X63432-1|CAA45026.1| 375|Homo sapiens mutant beta-actin (beta'... 72 8e-13 X04098-1|CAA27723.1| 375|Homo sapiens gamma-actin protein. 72 8e-13 X00351-1|CAA25099.1| 375|Homo sapiens protein ( Human mRNA for ... 72 8e-13 V00478-1|CAA23745.1| 124|Homo sapiens protein ( Human mRNA frag... 72 8e-13 M19283-1|AAA51579.1| 375|Homo sapiens ACTG1 protein. 72 8e-13 M10277-1|AAA51567.1| 375|Homo sapiens protein ( Human cytoplasm... 72 8e-13 DQ471327-1|ABF01018.1| 375|Homo sapiens PS1TP5-binding protein ... 72 8e-13 BT019856-1|AAV38659.1| 375|Homo sapiens actin, gamma 1 protein. 72 8e-13 BC053572-1|AAH53572.1| 375|Homo sapiens actin, gamma 1 protein. 72 8e-13 BC023548-1|AAH23548.1| 263|Homo sapiens ACTG1 protein protein. 72 8e-13 BC018774-1|AAH18774.1| 375|Homo sapiens ACTG1 protein protein. 72 8e-13 BC017450-1|AAH17450.1| 363|Homo sapiens Unknown (protein for IM... 72 8e-13 BC016045-1|AAH16045.1| 375|Homo sapiens actin, beta protein. 72 8e-13 BC015779-1|AAH15779.1| 375|Homo sapiens ACTG1 protein protein. 72 8e-13 BC015695-1|AAH15695.1| 375|Homo sapiens actin, gamma 1 protein. 72 8e-13 BC015005-1|AAH15005.1| 375|Homo sapiens ACTG1 protein protein. 72 8e-13 BC014861-1|AAH14861.1| 375|Homo sapiens actin, beta protein. 72 8e-13 BC013380-1|AAH13380.1| 375|Homo sapiens actin, beta protein. 72 8e-13 BC012854-1|AAH12854.1| 360|Homo sapiens ACTB protein protein. 72 8e-13 BC012050-1|AAH12050.1| 375|Homo sapiens actin, gamma 1 protein. 72 8e-13 BC010999-1|AAH10999.1| 375|Homo sapiens actin, gamma 1 protein. 72 8e-13 BC010417-1|AAH10417.2| 165|Homo sapiens ACTG1 protein protein. 72 8e-13 BC009848-1|AAH09848.1| 375|Homo sapiens actin, gamma 1 protein. 72 8e-13 BC009544-1|AAH09544.1| 159|Homo sapiens Unknown (protein for IM... 72 8e-13 BC008633-1|AAH08633.1| 368|Homo sapiens actin, beta protein. 72 8e-13 BC007442-1|AAH07442.1| 375|Homo sapiens actin, gamma 1 protein. 72 8e-13 BC004251-1|AAH04251.1| 375|Homo sapiens actin, beta protein. 72 8e-13 BC002409-1|AAH02409.1| 375|Homo sapiens actin, beta protein. 72 8e-13 BC001920-1|AAH01920.1| 375|Homo sapiens ACTG1 protein protein. 72 8e-13 BC001301-1|AAH01301.1| 375|Homo sapiens actin, beta protein. 72 8e-13 BC000292-1|AAH00292.1| 375|Homo sapiens actin, gamma 1 protein. 72 8e-13 AY582799-1|AAS79319.1| 375|Homo sapiens actin, beta protein. 72 8e-13 AK223032-1|BAD96752.1| 375|Homo sapiens beta actin variant prot... 72 8e-13 AC006483-1|AAP22343.1| 375|Homo sapiens unknown protein. 72 8e-13 AK222925-1|BAD96645.1| 375|Homo sapiens beta actin variant prot... 71 1e-12 X13839-1|CAA32064.1| 377|Homo sapiens protein ( Human mRNA for ... 71 2e-12 M33216-1|AAA60560.1| 47|Homo sapiens smooth muscle alpha-actin... 71 2e-12 J05192-1|AAA51577.1| 377|Homo sapiens ACTA3 protein. 71 2e-12 J00073-1|AAB59619.1| 377|Homo sapiens alpha-cardiac actin protein. 71 2e-12 CR541795-1|CAG46594.1| 377|Homo sapiens ACTC protein. 71 2e-12 CR536518-1|CAG38756.1| 377|Homo sapiens ACTA2 protein. 71 2e-12 BC093052-1|AAH93052.1| 377|Homo sapiens actin, alpha 2, smooth ... 71 2e-12 BC017554-1|AAH17554.1| 377|Homo sapiens actin, alpha 2, smooth ... 71 2e-12 BC009978-1|AAH09978.1| 377|Homo sapiens actin, alpha, cardiac m... 71 2e-12 AY692464-1|AAW29811.1| 377|Homo sapiens growth-inhibiting gene ... 71 2e-12 AL157394-6|CAI13864.1| 377|Homo sapiens actin, alpha 2, smooth ... 71 2e-12 M16247-1|AAA51580.1| 232|Homo sapiens ACTG1 protein. 70 2e-12 M20543-1|AAA60296.1| 377|Homo sapiens ACTA1 protein. 69 4e-12 J00068-1|AAB59376.1| 377|Homo sapiens ACTA1 protein. 69 4e-12 EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin prot... 69 4e-12 CR541796-1|CAG46595.1| 377|Homo sapiens ACTA1 protein. 69 4e-12 CR536516-1|CAG38754.1| 377|Homo sapiens ACTA1 protein. 69 4e-12 BC012597-1|AAH12597.1| 377|Homo sapiens actin, alpha 1, skeleta... 69 4e-12 AY280960-1|AAP37280.1| 254|Homo sapiens actin alpha 1 skeletal ... 69 4e-12 AL160004-6|CAI19050.1| 377|Homo sapiens actin, alpha 1, skeleta... 69 4e-12 AL160004-5|CAI19052.1| 342|Homo sapiens actin, alpha 1, skeleta... 69 4e-12 AL160004-4|CAI19051.1| 287|Homo sapiens actin, alpha 1, skeleta... 69 4e-12 AF182035-1|AAF02694.1| 377|Homo sapiens skeletal muscle alpha-a... 69 4e-12 AK223055-1|BAD96775.1| 375|Homo sapiens beta actin variant prot... 69 6e-12 X16940-1|CAA34814.1| 376|Homo sapiens protein ( Human mRNA for ... 68 1e-11 D00654-1|BAA00546.1| 376|Homo sapiens enteric smooth muscle gam... 68 1e-11 CR541794-1|CAG46593.1| 376|Homo sapiens ACTG2 protein. 68 1e-11 CR536515-1|CAG38753.1| 376|Homo sapiens ACTG2 protein. 68 1e-11 BC094877-1|AAH94877.1| 376|Homo sapiens ACTG2 protein protein. 68 1e-11 BC012617-1|AAH12617.1| 376|Homo sapiens actin, gamma 2, smooth ... 68 1e-11 AC073046-2|AAX88909.1| 376|Homo sapiens unknown protein. 68 1e-11 BC092424-1|AAH92424.1| 219|Homo sapiens Unknown (protein for MG... 67 2e-11 CR533529-1|CAG38560.1| 429|Homo sapiens BAF53A protein. 54 1e-07 BC036371-1|AAH36371.1| 429|Homo sapiens actin-like 6A protein. 54 1e-07 BC020944-1|AAH20944.1| 426|Homo sapiens actin-like 6B protein. 54 1e-07 BC001391-1|AAH01391.1| 429|Homo sapiens actin-like 6A protein. 54 1e-07 BC000949-1|AAH00949.1| 387|Homo sapiens actin-like 6A protein. 54 1e-07 AK223212-1|BAD96932.1| 429|Homo sapiens actin-like 6A isoform 1... 54 1e-07 AF041475-1|AAD54678.1| 426|Homo sapiens BAF53b protein. 54 1e-07 AF041474-1|AAC94991.1| 429|Homo sapiens BAF53a protein. 54 1e-07 AC099394-1|AAP21874.1| 426|Homo sapiens unknown protein. 54 1e-07 AB061315-1|BAB87848.1| 387|Homo sapiens hArpNbeta-s protein. 54 1e-07 AB060168-1|BAB87844.1| 387|Homo sapiens hArpNbeta-s protein. 54 1e-07 AB015907-1|BAA74577.1| 429|Homo sapiens actin-related protein h... 54 1e-07 AB015906-1|BAA74576.1| 426|Homo sapiens actin-related protein h... 54 1e-07 BC007289-1|AAH07289.1| 372|Homo sapiens actin related protein M... 51 2e-06 AK055346-1|BAB70906.1| 372|Homo sapiens protein ( Homo sapiens ... 51 2e-06 AB049117-1|BAB39481.1| 372|Homo sapiens actin related protein p... 51 2e-06 X82207-1|CAA57691.1| 376|Homo sapiens beta-centracetin protein. 50 3e-06 BC010090-1|AAH10090.1| 376|Homo sapiens ARP1 actin-related prot... 50 3e-06 BC006372-1|AAH06372.1| 376|Homo sapiens ARP1 actin-related prot... 50 3e-06 BC004374-1|AAH04374.1| 376|Homo sapiens ARP1 actin-related prot... 50 3e-06 AC017099-2|AAY24280.1| 376|Homo sapiens unknown protein. 50 3e-06 Z14978-1|CAA78701.1| 376|Homo sapiens actin-related protein pro... 50 4e-06 X82206-1|CAA57690.1| 376|Homo sapiens alpha-centractin protein. 50 4e-06 BC026016-1|AAH26016.1| 376|Homo sapiens ARP1 actin-related prot... 50 4e-06 BC000693-1|AAH00693.1| 376|Homo sapiens ARP1 actin-related prot... 50 4e-06 AL121928-12|CAC08404.1| 376|Homo sapiens ARP1 actin-related pro... 50 4e-06 BC045752-1|AAH45752.1| 416|Homo sapiens hypothetical protein MG... 48 1e-05 BC024028-1|AAH24028.1| 416|Homo sapiens hypothetical protein MG... 48 1e-05 BC033789-1|AAH33789.1| 415|Homo sapiens actin-like 7B protein. 45 1e-04 AL359692-3|CAI40570.1| 415|Homo sapiens actin-like 7B protein. 45 1e-04 AF113527-1|AAD44110.1| 415|Homo sapiens actin-like-7-beta protein. 45 1e-04 AB284521-1|BAF41972.1| 415|Homo sapiens t-actin 1 protein. 45 1e-04 BC014610-1|AAH14610.1| 435|Homo sapiens actin-like 7A protein. 44 1e-04 AL359692-4|CAI40571.1| 435|Homo sapiens actin-like 7A protein. 44 1e-04 AF113526-1|AAD44109.1| 435|Homo sapiens actin-like-7-alpha prot... 44 1e-04 AB284520-1|BAF41971.1| 435|Homo sapiens human t-actin 2 protein. 44 1e-04 Z74696-1|CAI42428.1| 376|Homo sapiens actin-related protein T1 ... 43 3e-04 BC029499-1|AAH29499.1| 376|Homo sapiens actin-related protein T... 43 3e-04 BC014597-1|AAH14597.1| 376|Homo sapiens actin-related protein T... 43 3e-04 AL356984-1|CAH72587.1| 377|Homo sapiens actin-related protein M... 43 3e-04 AF440740-1|AAM00433.1| 377|Homo sapiens actin-related protein T... 43 3e-04 AF440739-1|AAM00432.1| 376|Homo sapiens actin-related protein T... 43 3e-04 AB057364-1|BAB85862.1| 377|Homo sapiens actin-related protein h... 43 3e-04 DQ407611-1|ABD66582.1| 151|Homo sapiens beta-actin protein. 38 0.016 BC028909-1|AAH28909.1| 366|Homo sapiens actin-like 8 protein. 31 1.8 AL136529-1|CAC15940.1| 366|Homo sapiens actin-like 8 protein. 31 1.8 AK057339-1|BAB71434.1| 366|Homo sapiens protein ( Homo sapiens ... 31 1.8 AL121906-3|CAI22126.1| 245|Homo sapiens chromosome 20 open read... 30 3.1 AK123403-1|BAC85607.1| 243|Homo sapiens protein ( Homo sapiens ... 29 4.1 BC044590-1|AAH44590.1| 418|Homo sapiens ARP3 actin-related prot... 29 5.5 AK126665-1|BAC86634.1| 1012|Homo sapiens protein ( Homo sapiens ... 29 5.5 AF127773-1|AAD51904.1| 418|Homo sapiens unknown protein. 29 5.5 AF006083-1|AAB64188.1| 418|Homo sapiens Arp3 protein. 29 5.5 AC110769-1|AAX93226.1| 418|Homo sapiens unknown protein. 29 5.5 AB209353-1|BAD92590.1| 369|Homo sapiens ARP3 actin-related prot... 29 5.5 AB127405-1|BAD03968.1| 1183|Homo sapiens SNAP-25-interacting pro... 29 5.5 BC008682-1|AAH08682.1| 418|Homo sapiens ARP3 actin-related prot... 28 9.5 AF023453-1|AAC98904.1| 418|Homo sapiens actin-related protein 3... 28 9.5 AB209174-1|BAD92411.1| 282|Homo sapiens actin-related protein 3... 28 9.5 AB028987-1|BAA83016.2| 1315|Homo sapiens KIAA1064 protein protein. 28 9.5 >X63432-1|CAA45026.1| 375|Homo sapiens mutant beta-actin (beta'-actin) protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >X04098-1|CAA27723.1| 375|Homo sapiens gamma-actin protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >X00351-1|CAA25099.1| 375|Homo sapiens protein ( Human mRNA for beta-actin. ). Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >V00478-1|CAA23745.1| 124|Homo sapiens protein ( Human mRNA fragment encoding cytoplasmic actin. (isolated from cultured epidermal cells grown from human foreskin). ). Length = 124 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 93 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 124 >M19283-1|AAA51579.1| 375|Homo sapiens ACTG1 protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >M10277-1|AAA51567.1| 375|Homo sapiens protein ( Human cytoplasmic beta-actin gene, complete cds. ). Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >DQ471327-1|ABF01018.1| 375|Homo sapiens PS1TP5-binding protein 1 protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BT019856-1|AAV38659.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC053572-1|AAH53572.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC023548-1|AAH23548.1| 263|Homo sapiens ACTG1 protein protein. Length = 263 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 232 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 263 >BC018774-1|AAH18774.1| 375|Homo sapiens ACTG1 protein protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC017450-1|AAH17450.1| 363|Homo sapiens Unknown (protein for IMAGE:3538275) protein. Length = 363 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 332 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 363 >BC016045-1|AAH16045.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC015779-1|AAH15779.1| 375|Homo sapiens ACTG1 protein protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC015695-1|AAH15695.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC015005-1|AAH15005.1| 375|Homo sapiens ACTG1 protein protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC014861-1|AAH14861.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC013380-1|AAH13380.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC012854-1|AAH12854.1| 360|Homo sapiens ACTB protein protein. Length = 360 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 329 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 360 >BC012050-1|AAH12050.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC010999-1|AAH10999.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC010417-1|AAH10417.2| 165|Homo sapiens ACTG1 protein protein. Length = 165 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 134 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 165 >BC009848-1|AAH09848.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC009544-1|AAH09544.1| 159|Homo sapiens Unknown (protein for IMAGE:3897065) protein. Length = 159 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 128 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 159 >BC008633-1|AAH08633.1| 368|Homo sapiens actin, beta protein. Length = 368 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 337 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 368 >BC007442-1|AAH07442.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC004251-1|AAH04251.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC002409-1|AAH02409.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC001920-1|AAH01920.1| 375|Homo sapiens ACTG1 protein protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC001301-1|AAH01301.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >BC000292-1|AAH00292.1| 375|Homo sapiens actin, gamma 1 protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >AY582799-1|AAS79319.1| 375|Homo sapiens actin, beta protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >AK223032-1|BAD96752.1| 375|Homo sapiens beta actin variant protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >AC006483-1|AAP22343.1| 375|Homo sapiens unknown protein. Length = 375 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >AK222925-1|BAD96645.1| 375|Homo sapiens beta actin variant protein. Length = 375 Score = 71.3 bits (167), Expect = 1e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 S+LASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SVLASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >X13839-1|CAA32064.1| 377|Homo sapiens protein ( Human mRNA for vascular smooth muscle alpha-actin. ). Length = 377 Score = 70.5 bits (165), Expect = 2e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDE+GPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 >M33216-1|AAA60560.1| 47|Homo sapiens smooth muscle alpha-actin protein. Length = 47 Score = 70.5 bits (165), Expect = 2e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDE+GPSIVHRKCF Sbjct: 16 SILASLSTFQQMWISKQEYDEAGPSIVHRKCF 47 >J05192-1|AAA51577.1| 377|Homo sapiens ACTA3 protein. Length = 377 Score = 70.5 bits (165), Expect = 2e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDE+GPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 >J00073-1|AAB59619.1| 377|Homo sapiens alpha-cardiac actin protein. Length = 377 Score = 70.5 bits (165), Expect = 2e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDE+GPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 >CR541795-1|CAG46594.1| 377|Homo sapiens ACTC protein. Length = 377 Score = 70.5 bits (165), Expect = 2e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDE+GPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 >CR536518-1|CAG38756.1| 377|Homo sapiens ACTA2 protein. Length = 377 Score = 70.5 bits (165), Expect = 2e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDE+GPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 >BC093052-1|AAH93052.1| 377|Homo sapiens actin, alpha 2, smooth muscle, aorta protein. Length = 377 Score = 70.5 bits (165), Expect = 2e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDE+GPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 >BC017554-1|AAH17554.1| 377|Homo sapiens actin, alpha 2, smooth muscle, aorta protein. Length = 377 Score = 70.5 bits (165), Expect = 2e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDE+GPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 >BC009978-1|AAH09978.1| 377|Homo sapiens actin, alpha, cardiac muscle 1 protein. Length = 377 Score = 70.5 bits (165), Expect = 2e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDE+GPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 >AY692464-1|AAW29811.1| 377|Homo sapiens growth-inhibiting gene 46 protein. Length = 377 Score = 70.5 bits (165), Expect = 2e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDE+GPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 >AL157394-6|CAI13864.1| 377|Homo sapiens actin, alpha 2, smooth muscle, aorta protein. Length = 377 Score = 70.5 bits (165), Expect = 2e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDE+GPSIVHRKCF Sbjct: 346 SILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 >M16247-1|AAA51580.1| 232|Homo sapiens ACTG1 protein. Length = 232 Score = 70.1 bits (164), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 5 ILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 ILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 202 ILASLSTFQQMWISKQEYDESGPSIVHRKCF 232 >M20543-1|AAA60296.1| 377|Homo sapiens ACTA1 protein. Length = 377 Score = 69.3 bits (162), Expect = 4e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWI+KQEYDE+GPSIVHRKCF Sbjct: 346 SILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377 >J00068-1|AAB59376.1| 377|Homo sapiens ACTA1 protein. Length = 377 Score = 69.3 bits (162), Expect = 4e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWI+KQEYDE+GPSIVHRKCF Sbjct: 346 SILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377 >EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin protein. Length = 1075 Score = 69.3 bits (162), Expect = 4e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKC 94 SILASLSTFQQMWISKQEYDESGPSIVHRKC Sbjct: 1044 SILASLSTFQQMWISKQEYDESGPSIVHRKC 1074 >CR541796-1|CAG46595.1| 377|Homo sapiens ACTA1 protein. Length = 377 Score = 69.3 bits (162), Expect = 4e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWI+KQEYDE+GPSIVHRKCF Sbjct: 346 SILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377 >CR536516-1|CAG38754.1| 377|Homo sapiens ACTA1 protein. Length = 377 Score = 69.3 bits (162), Expect = 4e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWI+KQEYDE+GPSIVHRKCF Sbjct: 346 SILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377 >BC012597-1|AAH12597.1| 377|Homo sapiens actin, alpha 1, skeletal muscle protein. Length = 377 Score = 69.3 bits (162), Expect = 4e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWI+KQEYDE+GPSIVHRKCF Sbjct: 346 SILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377 >AY280960-1|AAP37280.1| 254|Homo sapiens actin alpha 1 skeletal muscle protein protein. Length = 254 Score = 69.3 bits (162), Expect = 4e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWI+KQEYDE+GPSIVHRKCF Sbjct: 223 SILASLSTFQQMWITKQEYDEAGPSIVHRKCF 254 >AL160004-6|CAI19050.1| 377|Homo sapiens actin, alpha 1, skeletal muscle protein. Length = 377 Score = 69.3 bits (162), Expect = 4e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWI+KQEYDE+GPSIVHRKCF Sbjct: 346 SILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377 >AL160004-5|CAI19052.1| 342|Homo sapiens actin, alpha 1, skeletal muscle protein. Length = 342 Score = 69.3 bits (162), Expect = 4e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWI+KQEYDE+GPSIVHRKCF Sbjct: 311 SILASLSTFQQMWITKQEYDEAGPSIVHRKCF 342 >AL160004-4|CAI19051.1| 287|Homo sapiens actin, alpha 1, skeletal muscle protein. Length = 287 Score = 69.3 bits (162), Expect = 4e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWI+KQEYDE+GPSIVHRKCF Sbjct: 256 SILASLSTFQQMWITKQEYDEAGPSIVHRKCF 287 >AF182035-1|AAF02694.1| 377|Homo sapiens skeletal muscle alpha-actin precursor protein. Length = 377 Score = 69.3 bits (162), Expect = 4e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWI+KQEYDE+GPSIVHRKCF Sbjct: 346 SILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377 >AK223055-1|BAD96775.1| 375|Homo sapiens beta actin variant protein. Length = 375 Score = 68.9 bits (161), Expect = 6e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SI ASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 344 SIPASLSTFQQMWISKQEYDESGPSIVHRKCF 375 >X16940-1|CAA34814.1| 376|Homo sapiens protein ( Human mRNA for enteric smooth muscle gamma-actin. ). Length = 376 Score = 68.1 bits (159), Expect = 1e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 345 SILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376 >D00654-1|BAA00546.1| 376|Homo sapiens enteric smooth muscle gamma-actin protein. Length = 376 Score = 68.1 bits (159), Expect = 1e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 345 SILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376 >CR541794-1|CAG46593.1| 376|Homo sapiens ACTG2 protein. Length = 376 Score = 68.1 bits (159), Expect = 1e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 345 SILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376 >CR536515-1|CAG38753.1| 376|Homo sapiens ACTG2 protein. Length = 376 Score = 68.1 bits (159), Expect = 1e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 345 SILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376 >BC094877-1|AAH94877.1| 376|Homo sapiens ACTG2 protein protein. Length = 376 Score = 68.1 bits (159), Expect = 1e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 345 SILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376 >BC012617-1|AAH12617.1| 376|Homo sapiens actin, gamma 2, smooth muscle, enteric protein. Length = 376 Score = 68.1 bits (159), Expect = 1e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 345 SILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376 >AC073046-2|AAX88909.1| 376|Homo sapiens unknown protein. Length = 376 Score = 68.1 bits (159), Expect = 1e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 345 SILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376 >BC092424-1|AAH92424.1| 219|Homo sapiens Unknown (protein for MGC:102982) protein. Length = 219 Score = 66.9 bits (156), Expect = 2e-11 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEY ES PSIVHRKCF Sbjct: 188 SILASLSTFQQMWISKQEYSESSPSIVHRKCF 219 >CR533529-1|CAG38560.1| 429|Homo sapiens BAF53A protein. Length = 429 Score = 54.4 bits (125), Expect = 1e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKC 94 SILASL TFQQMWISKQEY+E G V RKC Sbjct: 398 SILASLGTFQQMWISKQEYEEGGKQCVERKC 428 >BC036371-1|AAH36371.1| 429|Homo sapiens actin-like 6A protein. Length = 429 Score = 54.4 bits (125), Expect = 1e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKC 94 SILASL TFQQMWISKQEY+E G V RKC Sbjct: 398 SILASLGTFQQMWISKQEYEEGGKQCVERKC 428 >BC020944-1|AAH20944.1| 426|Homo sapiens actin-like 6B protein. Length = 426 Score = 54.4 bits (125), Expect = 1e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKC 94 SILASL TFQQMWISKQEY+E G V RKC Sbjct: 395 SILASLGTFQQMWISKQEYEEGGKQCVERKC 425 >BC001391-1|AAH01391.1| 429|Homo sapiens actin-like 6A protein. Length = 429 Score = 54.4 bits (125), Expect = 1e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKC 94 SILASL TFQQMWISKQEY+E G V RKC Sbjct: 398 SILASLGTFQQMWISKQEYEEGGKQCVERKC 428 >BC000949-1|AAH00949.1| 387|Homo sapiens actin-like 6A protein. Length = 387 Score = 54.4 bits (125), Expect = 1e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKC 94 SILASL TFQQMWISKQEY+E G V RKC Sbjct: 356 SILASLGTFQQMWISKQEYEEGGKQCVERKC 386 >AK223212-1|BAD96932.1| 429|Homo sapiens actin-like 6A isoform 1 variant protein. Length = 429 Score = 54.4 bits (125), Expect = 1e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKC 94 SILASL TFQQMWISKQEY+E G V RKC Sbjct: 398 SILASLGTFQQMWISKQEYEEGGKQCVERKC 428 >AF041475-1|AAD54678.1| 426|Homo sapiens BAF53b protein. Length = 426 Score = 54.4 bits (125), Expect = 1e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKC 94 SILASL TFQQMWISKQEY+E G V RKC Sbjct: 395 SILASLGTFQQMWISKQEYEEGGKQCVERKC 425 >AF041474-1|AAC94991.1| 429|Homo sapiens BAF53a protein. Length = 429 Score = 54.4 bits (125), Expect = 1e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKC 94 SILASL TFQQMWISKQEY+E G V RKC Sbjct: 398 SILASLGTFQQMWISKQEYEEGGKQCVERKC 428 >AC099394-1|AAP21874.1| 426|Homo sapiens unknown protein. Length = 426 Score = 54.4 bits (125), Expect = 1e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKC 94 SILASL TFQQMWISKQEY+E G V RKC Sbjct: 395 SILASLGTFQQMWISKQEYEEGGKQCVERKC 425 >AB061315-1|BAB87848.1| 387|Homo sapiens hArpNbeta-s protein. Length = 387 Score = 54.4 bits (125), Expect = 1e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKC 94 SILASL TFQQMWISKQEY+E G V RKC Sbjct: 356 SILASLGTFQQMWISKQEYEEGGKQCVERKC 386 >AB060168-1|BAB87844.1| 387|Homo sapiens hArpNbeta-s protein. Length = 387 Score = 54.4 bits (125), Expect = 1e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKC 94 SILASL TFQQMWISKQEY+E G V RKC Sbjct: 356 SILASLGTFQQMWISKQEYEEGGKQCVERKC 386 >AB015907-1|BAA74577.1| 429|Homo sapiens actin-related protein hArpN beta protein. Length = 429 Score = 54.4 bits (125), Expect = 1e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKC 94 SILASL TFQQMWISKQEY+E G V RKC Sbjct: 398 SILASLGTFQQMWISKQEYEEGGKQCVERKC 428 >AB015906-1|BAA74576.1| 426|Homo sapiens actin-related protein hArpN alpha protein. Length = 426 Score = 54.4 bits (125), Expect = 1e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKC 94 SILASL TFQQMWISKQEY+E G V RKC Sbjct: 395 SILASLGTFQQMWISKQEYEEGGKQCVERKC 425 >BC007289-1|AAH07289.1| 372|Homo sapiens actin related protein M1 protein. Length = 372 Score = 50.8 bits (116), Expect = 2e-06 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLS FQ MWI+ E+ E GP+IVH++CF Sbjct: 341 SILASLSAFQDMWITAAEFKEVGPNIVHQRCF 372 >AK055346-1|BAB70906.1| 372|Homo sapiens protein ( Homo sapiens cDNA FLJ30784 fis, clone FEBRA2000881, moderately similar to ACTIN 6. ). Length = 372 Score = 50.8 bits (116), Expect = 2e-06 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLS FQ MWI+ E+ E GP+IVH++CF Sbjct: 341 SILASLSAFQDMWITAAEFKEVGPNIVHQRCF 372 >AB049117-1|BAB39481.1| 372|Homo sapiens actin related protein protein. Length = 372 Score = 50.8 bits (116), Expect = 2e-06 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLS FQ MWI+ E+ E GP+IVH++CF Sbjct: 341 SILASLSAFQDMWITAAEFKEVGPNIVHQRCF 372 >X82207-1|CAA57691.1| 376|Homo sapiens beta-centracetin protein. Length = 376 Score = 50.0 bits (114), Expect = 3e-06 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASL TF++MW+SK+EY+E G +HRK F Sbjct: 345 SILASLDTFKKMWVSKKEYEEDGSRAIHRKTF 376 >BC010090-1|AAH10090.1| 376|Homo sapiens ARP1 actin-related protein 1 homolog B, centractin beta (yeast) protein. Length = 376 Score = 50.0 bits (114), Expect = 3e-06 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASL TF++MW+SK+EY+E G +HRK F Sbjct: 345 SILASLDTFKKMWVSKKEYEEDGSRAIHRKTF 376 >BC006372-1|AAH06372.1| 376|Homo sapiens ARP1 actin-related protein 1 homolog B, centractin beta (yeast) protein. Length = 376 Score = 50.0 bits (114), Expect = 3e-06 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASL TF++MW+SK+EY+E G +HRK F Sbjct: 345 SILASLDTFKKMWVSKKEYEEDGSRAIHRKTF 376 >BC004374-1|AAH04374.1| 376|Homo sapiens ARP1 actin-related protein 1 homolog B, centractin beta (yeast) protein. Length = 376 Score = 50.0 bits (114), Expect = 3e-06 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASL TF++MW+SK+EY+E G +HRK F Sbjct: 345 SILASLDTFKKMWVSKKEYEEDGSRAIHRKTF 376 >AC017099-2|AAY24280.1| 376|Homo sapiens unknown protein. Length = 376 Score = 50.0 bits (114), Expect = 3e-06 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASL TF++MW+SK+EY+E G +HRK F Sbjct: 345 SILASLDTFKKMWVSKKEYEEDGSRAIHRKTF 376 >Z14978-1|CAA78701.1| 376|Homo sapiens actin-related protein protein. Length = 376 Score = 49.6 bits (113), Expect = 4e-06 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASL TF++MW+SK+EY+E G +HRK F Sbjct: 345 SILASLDTFKKMWVSKKEYEEDGARSIHRKTF 376 >X82206-1|CAA57690.1| 376|Homo sapiens alpha-centractin protein. Length = 376 Score = 49.6 bits (113), Expect = 4e-06 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASL TF++MW+SK+EY+E G +HRK F Sbjct: 345 SILASLDTFKKMWVSKKEYEEDGARSIHRKTF 376 >BC026016-1|AAH26016.1| 376|Homo sapiens ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) protein. Length = 376 Score = 49.6 bits (113), Expect = 4e-06 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASL TF++MW+SK+EY+E G +HRK F Sbjct: 345 SILASLDTFKKMWVSKKEYEEDGARSIHRKTF 376 >BC000693-1|AAH00693.1| 376|Homo sapiens ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) protein. Length = 376 Score = 49.6 bits (113), Expect = 4e-06 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASL TF++MW+SK+EY+E G +HRK F Sbjct: 345 SILASLDTFKKMWVSKKEYEEDGARSIHRKTF 376 >AL121928-12|CAC08404.1| 376|Homo sapiens ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) protein. Length = 376 Score = 49.6 bits (113), Expect = 4e-06 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASL TF++MW+SK+EY+E G +HRK F Sbjct: 345 SILASLDTFKKMWVSKKEYEEDGARSIHRKTF 376 >BC045752-1|AAH45752.1| 416|Homo sapiens hypothetical protein MGC33407 protein. Length = 416 Score = 47.6 bits (108), Expect = 1e-05 Identities = 18/32 (56%), Positives = 25/32 (78%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASL FQ W+ +++Y+E GP IV+RKC+ Sbjct: 385 SILASLRAFQSCWVLREQYEEQGPYIVYRKCY 416 >BC024028-1|AAH24028.1| 416|Homo sapiens hypothetical protein MGC33407 protein. Length = 416 Score = 47.6 bits (108), Expect = 1e-05 Identities = 18/32 (56%), Positives = 25/32 (78%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASL FQ W+ +++Y+E GP IV+RKC+ Sbjct: 385 SILASLRAFQSCWVLREQYEEQGPYIVYRKCY 416 >BC033789-1|AAH33789.1| 415|Homo sapiens actin-like 7B protein. Length = 415 Score = 44.8 bits (101), Expect = 1e-04 Identities = 17/31 (54%), Positives = 24/31 (77%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKC 94 SILASL FQQ+W+SK+E++E G ++ KC Sbjct: 385 SILASLQAFQQLWVSKEEFEERGSVAIYSKC 415 >AL359692-3|CAI40570.1| 415|Homo sapiens actin-like 7B protein. Length = 415 Score = 44.8 bits (101), Expect = 1e-04 Identities = 17/31 (54%), Positives = 24/31 (77%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKC 94 SILASL FQQ+W+SK+E++E G ++ KC Sbjct: 385 SILASLQAFQQLWVSKEEFEERGSVAIYSKC 415 >AF113527-1|AAD44110.1| 415|Homo sapiens actin-like-7-beta protein. Length = 415 Score = 44.8 bits (101), Expect = 1e-04 Identities = 17/31 (54%), Positives = 24/31 (77%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKC 94 SILASL FQQ+W+SK+E++E G ++ KC Sbjct: 385 SILASLQAFQQLWVSKEEFEERGSVAIYSKC 415 >AB284521-1|BAF41972.1| 415|Homo sapiens t-actin 1 protein. Length = 415 Score = 44.8 bits (101), Expect = 1e-04 Identities = 17/31 (54%), Positives = 24/31 (77%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKC 94 SILASL FQQ+W+SK+E++E G ++ KC Sbjct: 385 SILASLQAFQQLWVSKEEFEERGSVAIYSKC 415 >BC014610-1|AAH14610.1| 435|Homo sapiens actin-like 7A protein. Length = 435 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASL FQ +W+ + EY+E GP ++R+CF Sbjct: 404 SILASLQGFQPLWVHRFEYEEHGPFFLYRRCF 435 >AL359692-4|CAI40571.1| 435|Homo sapiens actin-like 7A protein. Length = 435 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASL FQ +W+ + EY+E GP ++R+CF Sbjct: 404 SILASLQGFQPLWVHRFEYEEHGPFFLYRRCF 435 >AF113526-1|AAD44109.1| 435|Homo sapiens actin-like-7-alpha protein. Length = 435 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASL FQ +W+ + EY+E GP ++R+CF Sbjct: 404 SILASLQGFQPLWVHRFEYEEHGPFFLYRRCF 435 >AB284520-1|BAF41971.1| 435|Homo sapiens human t-actin 2 protein. Length = 435 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASL FQ +W+ + EY+E GP ++R+CF Sbjct: 404 SILASLQGFQPLWVHRFEYEEHGPFFLYRRCF 435 >Z74696-1|CAI42428.1| 376|Homo sapiens actin-related protein T1 (ACTRT1) protein. Length = 376 Score = 43.2 bits (97), Expect = 3e-04 Identities = 15/32 (46%), Positives = 25/32 (78%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SI+ S+S+F+QMW++ ++ E G S+V R+CF Sbjct: 345 SIMTSMSSFKQMWVTSADFKEYGTSVVQRRCF 376 >BC029499-1|AAH29499.1| 376|Homo sapiens actin-related protein T2 protein. Length = 376 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/32 (50%), Positives = 25/32 (78%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SI+ SLS+F+QMW++ ++ E G S+V R+CF Sbjct: 345 SIVTSLSSFKQMWVTAADFKEFGTSVVQRRCF 376 >BC014597-1|AAH14597.1| 376|Homo sapiens actin-related protein T1 protein. Length = 376 Score = 43.2 bits (97), Expect = 3e-04 Identities = 15/32 (46%), Positives = 25/32 (78%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SI+ S+S+F+QMW++ ++ E G S+V R+CF Sbjct: 345 SIMTSMSSFKQMWVTSADFKEYGTSVVQRRCF 376 >AL356984-1|CAH72587.1| 377|Homo sapiens actin-related protein M2 (ARPM2) protein. Length = 377 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/32 (50%), Positives = 25/32 (78%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SI+ SLS+F+QMW++ ++ E G S+V R+CF Sbjct: 346 SIVTSLSSFKQMWVTAADFKEFGTSVVQRRCF 377 >AF440740-1|AAM00433.1| 377|Homo sapiens actin-related protein T2 protein. Length = 377 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/32 (50%), Positives = 25/32 (78%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SI+ SLS+F+QMW++ ++ E G S+V R+CF Sbjct: 346 SIVTSLSSFKQMWVTAADFKEFGTSVVQRRCF 377 >AF440739-1|AAM00432.1| 376|Homo sapiens actin-related protein T1 protein. Length = 376 Score = 43.2 bits (97), Expect = 3e-04 Identities = 15/32 (46%), Positives = 25/32 (78%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SI+ S+S+F+QMW++ ++ E G S+V R+CF Sbjct: 345 SIMTSMSSFKQMWVTSADFKEYGTSVVQRRCF 376 >AB057364-1|BAB85862.1| 377|Homo sapiens actin-related protein hArpM2 protein. Length = 377 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/32 (50%), Positives = 25/32 (78%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SI+ SLS+F+QMW++ ++ E G S+V R+CF Sbjct: 346 SIVTSLSSFKQMWVTAADFKEFGTSVVQRRCF 377 >DQ407611-1|ABD66582.1| 151|Homo sapiens beta-actin protein. Length = 151 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQ 52 SILASLSTFQQMWISKQ Sbjct: 135 SILASLSTFQQMWISKQ 151 >BC028909-1|AAH28909.1| 366|Homo sapiens actin-like 8 protein. Length = 366 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/21 (52%), Positives = 17/21 (80%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDE 64 S++A LST+Q W+S++EY E Sbjct: 342 SVVAHLSTYQSEWMSREEYGE 362 >AL136529-1|CAC15940.1| 366|Homo sapiens actin-like 8 protein. Length = 366 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/21 (52%), Positives = 17/21 (80%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDE 64 S++A LST+Q W+S++EY E Sbjct: 342 SVVAHLSTYQSEWMSREEYGE 362 >AK057339-1|BAB71434.1| 366|Homo sapiens protein ( Homo sapiens cDNA FLJ32777 fis, clone TESTI2002057, highly similar to Human actin-like peptide mRNA. ). Length = 366 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/21 (52%), Positives = 17/21 (80%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDE 64 S++A LST+Q W+S++EY E Sbjct: 342 SVVAHLSTYQSEWMSREEYGE 362 >AL121906-3|CAI22126.1| 245|Homo sapiens chromosome 20 open reading frame 134 protein. Length = 245 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVH 85 S++ASL +FQ+ WI++ Y E G +++ Sbjct: 214 SMVASLHSFQRRWITRAMYQECGSRLLY 241 >AK123403-1|BAC85607.1| 243|Homo sapiens protein ( Homo sapiens cDNA FLJ41409 fis, clone BRHIP2000920. ). Length = 243 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +3 Query: 15 PSLPSNRCGSRNRSTTSLAPPLYTGSASKRTARRCLQQPAAGC 143 PS + R R R +SLAPP T A +T++ L+ P GC Sbjct: 30 PSPCTGRPEQRGRRKSSLAPPAPTPDAGPQTSKD-LEPPPHGC 71 >BC044590-1|AAH44590.1| 418|Homo sapiens ARP3 actin-related protein 3 homolog (yeast) protein. Length = 418 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSI 79 S+LAS F Q+ +K++Y+E GPSI Sbjct: 382 SMLASTPEFYQVCHTKKDYEEIGPSI 407 >AK126665-1|BAC86634.1| 1012|Homo sapiens protein ( Homo sapiens cDNA FLJ44709 fis, clone BRACE3019570, highly similar to Rattus norvegicus SNAP-25-interacting protein (SNIP). ). Length = 1012 Score = 29.1 bits (62), Expect = 5.5 Identities = 22/52 (42%), Positives = 24/52 (46%), Gaps = 8/52 (15%) Frame = +3 Query: 6 SSPPSLPSN-----RCGSRNRSTTSLA---PPLYTGSASKRTARRCLQQPAA 137 S PP LPS + GS +RS S A PP Y GS A R PAA Sbjct: 179 SPPPGLPSGLPSGLQSGSPSRSRLSYAGGRPPSYAGSPVHHAAERLGGAPAA 230 >AF127773-1|AAD51904.1| 418|Homo sapiens unknown protein. Length = 418 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSI 79 S+LAS F Q+ +K++Y+E GPSI Sbjct: 382 SMLASTPEFYQVCHTKKDYEEIGPSI 407 >AF006083-1|AAB64188.1| 418|Homo sapiens Arp3 protein. Length = 418 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSI 79 S+LAS F Q+ +K++Y+E GPSI Sbjct: 382 SMLASTPEFYQVCHTKKDYEEIGPSI 407 >AC110769-1|AAX93226.1| 418|Homo sapiens unknown protein. Length = 418 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSI 79 S+LAS F Q+ +K++Y+E GPSI Sbjct: 382 SMLASTPEFYQVCHTKKDYEEIGPSI 407 >AB209353-1|BAD92590.1| 369|Homo sapiens ARP3 actin-related protein 3 homolog variant protein. Length = 369 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSI 79 S+LAS F Q+ +K++Y+E GPSI Sbjct: 333 SMLASTPEFYQVCHTKKDYEEIGPSI 358 >AB127405-1|BAD03968.1| 1183|Homo sapiens SNAP-25-interacting protein protein. Length = 1183 Score = 29.1 bits (62), Expect = 5.5 Identities = 22/52 (42%), Positives = 24/52 (46%), Gaps = 8/52 (15%) Frame = +3 Query: 6 SSPPSLPSN-----RCGSRNRSTTSLA---PPLYTGSASKRTARRCLQQPAA 137 S PP LPS + GS +RS S A PP Y GS A R PAA Sbjct: 307 SPPPGLPSGLPSGLQSGSPSRSRLSYAGGRPPSYAGSPVHHAAERLGGAPAA 358 >BC008682-1|AAH08682.1| 418|Homo sapiens ARP3 actin-related protein 3 homolog B (yeast) protein. Length = 418 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSI 79 S+LAS F Q+ +K++Y+E GPSI Sbjct: 382 SMLASTPEFFQVCHTKKDYEEYGPSI 407 >AF023453-1|AAC98904.1| 418|Homo sapiens actin-related protein 3-beta protein. Length = 418 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSI 79 S+LAS F Q+ +K++Y+E GPSI Sbjct: 382 SMLASTPEFFQVCHTKKDYEEYGPSI 407 >AB209174-1|BAD92411.1| 282|Homo sapiens actin-related protein 3-beta variant protein. Length = 282 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSI 79 S+LAS F Q+ +K++Y+E GPSI Sbjct: 246 SMLASTPEFFQVCHTKKDYEEYGPSI 271 >AB028987-1|BAA83016.2| 1315|Homo sapiens KIAA1064 protein protein. Length = 1315 Score = 28.3 bits (60), Expect = 9.5 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +2 Query: 38 WISKQEYDESGPSIVH-RKCF*THRASLPPAARGRLLNSGL*SP 166 W S E DE G S+ K +S PPA+ G L +SGL P Sbjct: 817 WYSSDE-DEGGSSVTSILKTLRQQTSSRPPASVGELSSSGLGDP 859 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 45,294,302 Number of Sequences: 237096 Number of extensions: 734433 Number of successful extensions: 2061 Number of sequences better than 10.0: 127 Number of HSP's better than 10.0 without gapping: 1962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2061 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2756025120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -