BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30155 (392 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X54848-1|CAA38618.1| 100|Drosophila melanogaster Actin protein. 72 3e-13 X06384-1|CAB61444.1| 53|Drosophila melanogaster protein ( Dros... 72 3e-13 K00670-1|AAA28314.1| 376|Drosophila melanogaster protein ( D.me... 72 3e-13 AY118907-1|AAM50767.1| 376|Drosophila melanogaster LD18090p pro... 72 3e-13 AY089562-1|AAL90300.1| 376|Drosophila melanogaster RE02927p pro... 72 3e-13 AE014298-815|AAX52480.1| 376|Drosophila melanogaster CG4027-PD,... 72 3e-13 AE014298-814|AAX52479.1| 376|Drosophila melanogaster CG4027-PC,... 72 3e-13 AE014298-813|AAN09154.1| 376|Drosophila melanogaster CG4027-PB,... 72 3e-13 AE014298-812|AAF46098.1| 376|Drosophila melanogaster CG4027-PA,... 72 3e-13 AE013599-130|AAF57294.1| 376|Drosophila melanogaster CG12051-PA... 72 3e-13 X12452-1|CAA30982.1| 376|Drosophila melanogaster 87E actin prot... 70 1e-12 M18830-1|AAA28321.1| 376|Drosophila melanogaster protein ( D.me... 70 1e-12 M18829-1|AAA28318.1| 376|Drosophila melanogaster protein ( D.me... 70 1e-12 M18827-1|AAA28317.1| 376|Drosophila melanogaster protein ( D.me... 70 1e-12 M18826-1|AAA28323.1| 376|Drosophila melanogaster protein ( D.me... 70 1e-12 K00674-1|AAA28320.1| 376|Drosophila melanogaster protein ( D.me... 70 1e-12 BT016152-1|AAV37037.1| 376|Drosophila melanogaster AT14584p pro... 70 1e-12 AY118735-1|AAM50595.1| 376|Drosophila melanogaster GH04529p pro... 70 1e-12 AY113405-1|AAM29410.1| 341|Drosophila melanogaster RE12057p pro... 70 1e-12 AY089587-1|AAL90325.1| 376|Drosophila melanogaster RE14441p pro... 70 1e-12 AE014297-2046|AAF55198.1| 376|Drosophila melanogaster CG5178-PA... 70 1e-12 AE014297-1691|AAN13567.1| 376|Drosophila melanogaster CG18290-P... 70 1e-12 AE014297-1690|AAF54950.2| 376|Drosophila melanogaster CG18290-P... 70 1e-12 AE014296-3645|AAF51800.1| 376|Drosophila melanogaster CG7478-PA... 70 1e-12 AB003910-1|BAA20058.1| 376|Drosophila melanogaster actin protein. 70 1e-12 K00673-1|AAA28319.1| 376|Drosophila melanogaster protein ( D.me... 69 2e-12 AY089535-1|AAL90273.1| 360|Drosophila melanogaster LD04994p pro... 69 2e-12 AE013599-3086|AAF46640.1| 376|Drosophila melanogaster CG10067-P... 69 2e-12 K00667-1|AAA28316.1| 376|Drosophila melanogaster protein ( D.me... 67 7e-12 AY070886-1|AAL48508.1| 425|Drosophila melanogaster LD29458p pro... 53 2e-07 AE013599-2461|AAF57868.1| 425|Drosophila melanogaster CG6546-PA... 53 2e-07 X78487-1|CAA55239.1| 376|Drosophila melanogaster actin related ... 52 4e-07 BT023874-1|AAZ86795.1| 368|Drosophila melanogaster AT26678p pro... 52 4e-07 AE013599-2340|AAF57954.1| 376|Drosophila melanogaster CG5409-PA... 52 4e-07 X78488-1|CAA55240.1| 376|Drosophila melanogaster actin related ... 51 5e-07 AY070666-1|AAL48137.1| 376|Drosophila melanogaster RH04757p pro... 51 5e-07 AE014297-1571|AAF54853.1| 376|Drosophila melanogaster CG6174-PA... 51 5e-07 X71789-1|CAA50674.1| 418|Drosophila melanogaster actin related ... 27 6.7 AY051859-1|AAK93283.1| 418|Drosophila melanogaster LD35711p pro... 27 6.7 AE014296-1370|AAF50488.1| 418|Drosophila melanogaster CG7558-PA... 27 6.7 >X54848-1|CAA38618.1| 100|Drosophila melanogaster Actin protein. Length = 100 Score = 71.7 bits (168), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 69 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 100 >X06384-1|CAB61444.1| 53|Drosophila melanogaster protein ( Drosophila 5C actingene 3' region (exon 3 part.). ). Length = 53 Score = 71.7 bits (168), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 22 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 53 >K00670-1|AAA28314.1| 376|Drosophila melanogaster protein ( D.melanogaster actingene, complete cds, locus 42A. ). Length = 376 Score = 71.7 bits (168), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >AY118907-1|AAM50767.1| 376|Drosophila melanogaster LD18090p protein. Length = 376 Score = 71.7 bits (168), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >AY089562-1|AAL90300.1| 376|Drosophila melanogaster RE02927p protein. Length = 376 Score = 71.7 bits (168), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >AE014298-815|AAX52480.1| 376|Drosophila melanogaster CG4027-PD, isoform D protein. Length = 376 Score = 71.7 bits (168), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >AE014298-814|AAX52479.1| 376|Drosophila melanogaster CG4027-PC, isoform C protein. Length = 376 Score = 71.7 bits (168), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >AE014298-813|AAN09154.1| 376|Drosophila melanogaster CG4027-PB, isoform B protein. Length = 376 Score = 71.7 bits (168), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >AE014298-812|AAF46098.1| 376|Drosophila melanogaster CG4027-PA, isoform A protein. Length = 376 Score = 71.7 bits (168), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >AE013599-130|AAF57294.1| 376|Drosophila melanogaster CG12051-PA protein. Length = 376 Score = 71.7 bits (168), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >X12452-1|CAA30982.1| 376|Drosophila melanogaster 87E actin protein. Length = 376 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGP IVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPGIVHRKCF 376 >M18830-1|AAA28321.1| 376|Drosophila melanogaster protein ( D.melanogaster actingene, complete cds, locus 88F. ). Length = 376 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 5 ILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 ILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 346 ILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >M18829-1|AAA28318.1| 376|Drosophila melanogaster protein ( D.melanogaster actingene, complete cds, locus 79B. ). Length = 376 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGP IVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPGIVHRKCF 376 >M18827-1|AAA28317.1| 376|Drosophila melanogaster protein ( D.melanogaster actingene, exon 2, locus 79B. ). Length = 376 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGP IVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPGIVHRKCF 376 >M18826-1|AAA28323.1| 376|Drosophila melanogaster protein ( D.melanogaster actingene, complete cds, locus 88F. ). Length = 376 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGP IVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPGIVHRKCF 376 >K00674-1|AAA28320.1| 376|Drosophila melanogaster protein ( D.melanogaster actingene, complete cds, locus 87E. ). Length = 376 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGP IVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPGIVHRKCF 376 >BT016152-1|AAV37037.1| 376|Drosophila melanogaster AT14584p protein. Length = 376 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGP IVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPGIVHRKCF 376 >AY118735-1|AAM50595.1| 376|Drosophila melanogaster GH04529p protein. Length = 376 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGP IVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPGIVHRKCF 376 >AY113405-1|AAM29410.1| 341|Drosophila melanogaster RE12057p protein. Length = 341 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGP IVHRKCF Sbjct: 310 SILASLSTFQQMWISKQEYDESGPGIVHRKCF 341 >AY089587-1|AAL90325.1| 376|Drosophila melanogaster RE14441p protein. Length = 376 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGP IVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPGIVHRKCF 376 >AE014297-2046|AAF55198.1| 376|Drosophila melanogaster CG5178-PA protein. Length = 376 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGP IVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPGIVHRKCF 376 >AE014297-1691|AAN13567.1| 376|Drosophila melanogaster CG18290-PB, isoform B protein. Length = 376 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGP IVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPGIVHRKCF 376 >AE014297-1690|AAF54950.2| 376|Drosophila melanogaster CG18290-PA, isoform A protein. Length = 376 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGP IVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPGIVHRKCF 376 >AE014296-3645|AAF51800.1| 376|Drosophila melanogaster CG7478-PA protein. Length = 376 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGP IVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPGIVHRKCF 376 >AB003910-1|BAA20058.1| 376|Drosophila melanogaster actin protein. Length = 376 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISKQEYDESGP IVHRKCF Sbjct: 345 SILASLSTFQQMWISKQEYDESGPGIVHRKCF 376 >K00673-1|AAA28319.1| 376|Drosophila melanogaster protein ( D.melanogaster actingene, exon 2, locus 57A. ). Length = 376 Score = 68.9 bits (161), Expect = 2e-12 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 345 SILASLSTFQQMWISKEEYDESGPGIVHRKCF 376 >AY089535-1|AAL90273.1| 360|Drosophila melanogaster LD04994p protein. Length = 360 Score = 68.9 bits (161), Expect = 2e-12 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 329 SILASLSTFQQMWISKEEYDESGPGIVHRKCF 360 >AE013599-3086|AAF46640.1| 376|Drosophila melanogaster CG10067-PA, isoform A protein. Length = 376 Score = 68.9 bits (161), Expect = 2e-12 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASLSTFQQMWISK+EYDESGP IVHRKCF Sbjct: 345 SILASLSTFQQMWISKEEYDESGPGIVHRKCF 376 >K00667-1|AAA28316.1| 376|Drosophila melanogaster protein ( D.melanogaster actingene, complete cds, locus 5C. ). Length = 376 Score = 67.3 bits (157), Expect = 7e-12 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILAS STFQQMW SKQEYDESGPSIVHRKCF Sbjct: 345 SILASSSTFQQMWTSKQEYDESGPSIVHRKCF 376 >AY070886-1|AAL48508.1| 425|Drosophila melanogaster LD29458p protein. Length = 425 Score = 52.8 bits (121), Expect = 2e-07 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKC 94 SILAS+ TFQQMWIS QEY+E+G S V RKC Sbjct: 394 SILASIGTFQQMWISSQEYEEAGKSQVERKC 424 >AE013599-2461|AAF57868.1| 425|Drosophila melanogaster CG6546-PA protein. Length = 425 Score = 52.8 bits (121), Expect = 2e-07 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKC 94 SILAS+ TFQQMWIS QEY+E+G S V RKC Sbjct: 394 SILASIGTFQQMWISSQEYEEAGKSQVERKC 424 >X78487-1|CAA55239.1| 376|Drosophila melanogaster actin related protein protein. Length = 376 Score = 51.6 bits (118), Expect = 4e-07 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 S+LASL++FQ MWI EY+E G +IVHRKCF Sbjct: 345 SVLASLTSFQNMWIDSLEYEEVGSAIVHRKCF 376 >BT023874-1|AAZ86795.1| 368|Drosophila melanogaster AT26678p protein. Length = 368 Score = 51.6 bits (118), Expect = 4e-07 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 S+LASL++FQ MWI EY+E G +IVHRKCF Sbjct: 337 SVLASLTSFQNMWIDSLEYEEVGSAIVHRKCF 368 >AE013599-2340|AAF57954.1| 376|Drosophila melanogaster CG5409-PA protein. Length = 376 Score = 51.6 bits (118), Expect = 4e-07 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 S+LASL++FQ MWI EY+E G +IVHRKCF Sbjct: 345 SVLASLTSFQNMWIDSLEYEEVGSAIVHRKCF 376 >X78488-1|CAA55240.1| 376|Drosophila melanogaster actin related protein protein. Length = 376 Score = 51.2 bits (117), Expect = 5e-07 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASL TF++MWISK+EY+E G VHRK F Sbjct: 345 SILASLDTFKKMWISKREYEEEGQKAVHRKTF 376 >AY070666-1|AAL48137.1| 376|Drosophila melanogaster RH04757p protein. Length = 376 Score = 51.2 bits (117), Expect = 5e-07 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASL TF++MWISK+EY+E G VHRK F Sbjct: 345 SILASLDTFKKMWISKREYEEEGQKAVHRKTF 376 >AE014297-1571|AAF54853.1| 376|Drosophila melanogaster CG6174-PA protein. Length = 376 Score = 51.2 bits (117), Expect = 5e-07 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 97 SILASL TF++MWISK+EY+E G VHRK F Sbjct: 345 SILASLDTFKKMWISKREYEEEGQKAVHRKTF 376 >X71789-1|CAA50674.1| 418|Drosophila melanogaster actin related protein protein. Length = 418 Score = 27.5 bits (58), Expect = 6.7 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIV-HRKCF*T 103 S+LAS F Q+ +K Y+E GPSI H F T Sbjct: 382 SMLASTPEFYQVCHTKAAYEEYGPSICRHNPVFGT 416 >AY051859-1|AAK93283.1| 418|Drosophila melanogaster LD35711p protein. Length = 418 Score = 27.5 bits (58), Expect = 6.7 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIV-HRKCF*T 103 S+LAS F Q+ +K Y+E GPSI H F T Sbjct: 382 SMLASTPEFYQVCHTKAAYEEYGPSICRHNPVFGT 416 >AE014296-1370|AAF50488.1| 418|Drosophila melanogaster CG7558-PA protein. Length = 418 Score = 27.5 bits (58), Expect = 6.7 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 2 SILASLSTFQQMWISKQEYDESGPSIV-HRKCF*T 103 S+LAS F Q+ +K Y+E GPSI H F T Sbjct: 382 SMLASTPEFYQVCHTKAAYEEYGPSICRHNPVFGT 416 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,300,265 Number of Sequences: 53049 Number of extensions: 238054 Number of successful extensions: 790 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 777 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 790 length of database: 24,988,368 effective HSP length: 77 effective length of database: 20,903,595 effective search space used: 1107890535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -