Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV30152X
         (524 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292355-1|CAL23167.1|  324|Tribolium castaneum gustatory recept...    23   1.6  
AM292360-1|CAL23172.2|  427|Tribolium castaneum gustatory recept...    21   8.8  
AM292331-1|CAL23143.2|  437|Tribolium castaneum gustatory recept...    21   8.8  

>AM292355-1|CAL23167.1|  324|Tribolium castaneum gustatory receptor
           candidate 34 protein.
          Length = 324

 Score = 23.0 bits (47), Expect = 1.6
 Identities = 16/66 (24%), Positives = 33/66 (50%)
 Frame = -1

Query: 521 LMIDILL*NTIIYGFLLYVQRLKINNYVYKICSTVYNYSSCSVRSHVYNYAIHFVCRKYG 342
           ++IDI + +  +YGF++Y+    I +   ++   + NY    + S  + Y +  +     
Sbjct: 130 VIIDIEIYSQFLYGFMIYLILDTIKSKYRQMHRLLANYK--VITSDEFFYLVSKIESLAC 187

Query: 341 QQKNTV 324
           + KNTV
Sbjct: 188 ELKNTV 193


>AM292360-1|CAL23172.2|  427|Tribolium castaneum gustatory receptor
           candidate 39 protein.
          Length = 427

 Score = 20.6 bits (41), Expect = 8.8
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +3

Query: 198 WHSEGFYH 221
           WH+ G+YH
Sbjct: 206 WHTFGYYH 213


>AM292331-1|CAL23143.2|  437|Tribolium castaneum gustatory receptor
           candidate 10 protein.
          Length = 437

 Score = 20.6 bits (41), Expect = 8.8
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +3

Query: 198 WHSEGFYH 221
           WH+ G+YH
Sbjct: 206 WHTFGYYH 213


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 125,401
Number of Sequences: 336
Number of extensions: 2795
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 12678017
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)