BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30152X (524 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g07530.1 68414.m00806 scarecrow-like transcription factor 14 ... 28 4.4 At1g08280.1 68414.m00914 glycosyl transferase family 29 protein ... 27 5.8 >At1g07530.1 68414.m00806 scarecrow-like transcription factor 14 (SCL14) identical to GB:AAD24412 from [Arabidopsis thaliana] (Plant J. 18 (1), 111-119 (1999)) Length = 769 Score = 27.9 bits (59), Expect = 4.4 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 Query: 266 TSTDNHWSVPGLHN 307 TS+D+HWSV GL N Sbjct: 166 TSSDSHWSVDGLEN 179 >At1g08280.1 68414.m00914 glycosyl transferase family 29 protein / sialyltransferase family protein contains Pfam profile: PF00777 sialyltransferase (Glycosyltransferase family 29) Length = 398 Score = 27.5 bits (58), Expect = 5.8 Identities = 28/109 (25%), Positives = 47/109 (43%), Gaps = 7/109 (6%) Frame = -1 Query: 314 YISC-----EARVRSSDYR*MYEMHNLLSNKRVNDIMIETF--RVPTITLLSFISMG*VA 156 Y+SC + +S Y + + H ++ R+N+ E F +V + T +SFI+ + Sbjct: 174 YLSCAVVGNSGTLLNSQYGDLIDKHEIVI--RLNNAKTERFEKKVGSKTNISFINSNILH 231 Query: 155 YAGH*HVKDRQTFIRKPSGCANGFAYSICEPVCASSYTCLRMSHEFLLL 9 G R++ P G IC+P+ YT + SH LL Sbjct: 232 QCGR-----RESCYCHPYGETVPIVMYICQPIHVLDYTLCKPSHRAPLL 275 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,475,024 Number of Sequences: 28952 Number of extensions: 200097 Number of successful extensions: 384 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 378 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 384 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 967280384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -